SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M8C201 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M8C201
Domain Number 1 Region: 314-461
Classification Level Classification E-value
Superfamily EF-hand 4.88e-44
Family Calmodulin-like 0.0000726
Further Details:      
 
Domain Number 2 Region: 115-289
Classification Level Classification E-value
Superfamily Mog1p/PsbP-like 3.45e-20
Family PsbP-like 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M8C201
Sequence length 468
Comment (tr|M8C201|M8C201_AEGTA) Putative calcium-binding protein CML8 {ECO:0000313|EMBL:EMT31275.1, ECO:0000313|EnsemblPlants:EMT31275} OX=37682 OS=Aegilops tauschii (Tausch's goatgrass) (Aegilops squarrosa). GN=F775_27078 OC=Pooideae; Triticodae; Triticeae; Triticinae; Aegilops.
Sequence
MAAALLSPASPLPRSSSAAHPSQLFHGQPCPLERPDSWELCRSKGAAGAAWCAPPSRRRA
VSCSCAPDSWSRGLERRQLVLSGLACSFAIVLPISVVESCAAAAEVDDDGVKMAMLVDET
NAYSFLYPVQLPGKKTSFRWVESRKSERYSSAAPLSREADILFAADARQRIVSERLDMIN
NAVISVSIGPPSSRFLPSKDKKTWAAKDVADCVLSDKSSLKVTTSQRMAESSVLDAHTTD
VDGEPYWYYEYIVRKSPTKSDGFVHSPFFSLGFLYSLNASTLSKQWESTSYFRGQRQEPS
SDDPRPGYRRDRGGRKRLTAQKRKEIKEAFDLFDTDGSGTIDARELNVAMRALGFEMTPE
QIQQMIAEVDKDGSGTIDLDEFIHMMTDKMGERDARDELHKAFRIIDQDANGKISDMDIQ
RLAIEAGEHFTLDEVREMIQAADENGDGEVDMEEFMKMMKRTGFGAGF
Download sequence
Identical sequences M8C201
EMT31275

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]