SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M8C4Q6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M8C4Q6
Domain Number 1 Region: 506-692
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.3e-44
Family Protein kinases, catalytic subunit 0.00089
Further Details:      
 
Domain Number 2 Region: 261-319,353-438
Classification Level Classification E-value
Superfamily Mannose-binding lectins 1.57e-32
Family Mannose-binding lectins 0.00042
Further Details:      
 
Domain Number 3 Region: 100-246
Classification Level Classification E-value
Superfamily Mannose-binding lectins 1.83e-32
Family Mannose-binding lectins 0.00022
Further Details:      
 
Domain Number 4 Region: 2-89
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.18e-26
Family B3 DNA binding domain 0.0000261
Further Details:      
 
Domain Number 5 Region: 723-838
Classification Level Classification E-value
Superfamily PapD-like 4.19e-16
Family MSP-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M8C4Q6
Sequence length 843
Comment (tr|M8C4Q6|M8C4Q6_AEGTA) B3 domain-containing protein {ECO:0000313|EMBL:EMT29229.1, ECO:0000313|EnsemblPlants:EMT29229} OX=37682 OS=Aegilops tauschii (Tausch's goatgrass) (Aegilops squarrosa). GN=F775_04153 OC=Pooideae; Triticodae; Triticeae; Triticinae; Aegilops.
Sequence
MFDKVVTPSDTGKLNRLVIPKQHAEKYFPLDASSNDNGLLLDFEDSAGKPWRFRYSYWNS
SQSYVMTKGWSRFVKETRLEAGDIVSFKRGVGEAARGRAYITKIGPWGGNRGNFNDIKVS
PLRLNSITIRSGEVIYSLAFSYSDNYGKQHHAGPSGGCKDFSYGSFDTIQLGPSEFLTKV
SGTIAFSAQYSSNVITSVMFITTARRYGPFGGGVGIPFQSPVMSNGSIVGFFAHAEWVVE
SIGLYVNSESKLWEPMKGQDSVTKIGPWGGDSGRPNDVNVLPRRLLSVVVRNSTVISSLT
FTYIDWDGQPQTAGPWGGLGESFDGKVDTGNPWVPKSMTFFTEYSLQHATLTITCYTKAE
IILGRSEFLTEVSGTLGWNSGYSDVVTSLYFVTNTGGYGPYGKGGGTRFRSSHSNGSIVG
FFVNAADVIDAIGVYFSPERETCKEKMLKIRLIWRKEALGFHVVWLTEKVDAVIRVEIES
ASNDLEHIVLDQSAEPTNLPLALLKDITEDFNDKRQIGRGGFGIVYKIIRGICDGLVYLH
TEKGIVHRDMKPENILLDDLMIPKITDFGISKLLDGATHAVTSDPTGSRGYCAPEFIARG
EVSTRSDIYSLGVIITELVTGCKDEPHIQNLDRVRAEVLRRWRYRWNESANYPPFGYQQV
SKCIEIALKCLSDSPKKRPKISDIVSMLNTMESTKEHITNVGNSPAGQISAYPWELLEFD
LLELNFPFEINKKIPCSLQLTNVTDDYVAFDIEMMGILRYCIEPEKRVVPPRSKCNVMVT
LQPHERVPHAMVCKDELFILRCAAVSEGLTAEDISEDMLNKKSGKEEADKVTLKVVILPI
TVD
Download sequence
Identical sequences M8C4Q6
EMT29229

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]