SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M8CAK6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M8CAK6
Domain Number 1 Region: 25-175
Classification Level Classification E-value
Superfamily Mannose-binding lectins 8.37e-39
Family Mannose-binding lectins 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M8CAK6
Sequence length 194
Comment (tr|M8CAK6|M8CAK6_AEGTA) Uncharacterized protein {ECO:0000313|EMBL:EMT12158.1, ECO:0000313|EnsemblPlants:EMT12158} OX=37682 OS=Aegilops tauschii (Tausch's goatgrass) (Aegilops squarrosa). GN=F775_16170 OC=Pooideae; Triticodae; Triticeae; Triticinae; Aegilops.
Sequence
MPCYLLHIRGLMAGARCVQVQGQSPVVKLGAWGSDGGAAHDIDVGVAPPHRLQSIALRWG
KVIDSLAFTYTDKDGQPHAAGPWGGAGGVSEDLITLGPSEYVTEVGWTVGPFKLKEIEAC
VTSLKFVTNLGTTHGPFGNGDGAHHSLPVLDAGSVVGMFCRAEDYLHAIGFYVRPLAVTE
STDSPAKPEGESLP
Download sequence
Identical sequences M8CAK6
EMT12158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]