SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M8CKU3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M8CKU3
Domain Number 1 Region: 173-342
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.16e-19
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.018
Further Details:      
 
Weak hits

Sequence:  M8CKU3
Domain Number - Region: 77-150
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0124
Family B3 DNA binding domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M8CKU3
Sequence length 407
Comment (tr|M8CKU3|M8CKU3_AEGTA) Uncharacterized protein {ECO:0000313|EMBL:EMT28012.1, ECO:0000313|EnsemblPlants:EMT28012} OX=37682 OS=Aegilops tauschii (Tausch's goatgrass) (Aegilops squarrosa). GN=F775_25033 OC=Pooideae; Triticodae; Triticeae; Triticinae; Aegilops.
Sequence
MPAFEYIHRPRKASSIRKFKGKKIHLKSGKYILHGEPCIHYLDEFSHHIVWGNTVTLYNH
NVRRLRKIICSTTTPDRYYVCHMTETFATHGKRMYFSIPFSTGSLFPHMYVDHGELPITT
GDRTTAVTTRFMKGVDKRATITKGWSDFFLVAFITNGEVVHGSGLKSDDDDKSCLLNVII
QSLWHLRGFRDDLLKTSSHHKHVGDPGAVSCVVCVLCHIFTELSKVSKGEGEAVAPTSLR
MALSISFPAEKLIRMGQMNDASEVLEAILRRMHDSFTYRADYLAESHERNCSGSWDCAND
ECIAHDMFGADVHERMICYNCGLESRQQKYTSFLHYINACSLNYAMRICPGNSFDDILKA
VMMDVHRTCDPDVGGCGKSNHMSHTLSSSPILPAEKVLESPSRVMTS
Download sequence
Identical sequences M8CKU3
EMT28012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]