SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M9UD94 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M9UD94
Domain Number 1 Region: 10-136
Classification Level Classification E-value
Superfamily Single hybrid motif 1.05e-34
Family Biotinyl/lipoyl-carrier proteins and domains 0.0000687
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M9UD94
Sequence length 148
Comment (tr|M9UD94|M9UD94_SULIS) Probable glycine cleavage system H protein {ECO:0000256|HAMAP-Rule:MF_00272} KW=Complete proteome OX=1241935 OS=Sulfolobus islandicus LAL14/1. GN=SiL_1041 OC=Sulfolobus.
Sequence
MVVESNCEIPENLYYFIEGKNTVWARLEGSDTIVVGITDLAQTMAGKIVKVRIKKKGTKV
EKGRPVATMESGKWAGPVPAPVTGEVVEVNAEAEKSPVIINQDPYGKGWLVKMKMSNPEE
LKQLVSGQAAIQKLKELIASEKLTCKRL
Download sequence
Identical sequences C3MPF3 C3MY14 C3N535 C3NDN2 C3NI19 C4KGN8 D2PJJ3 F0NGT3 F0NK76 M9UD94
gi|479325441|ref|YP_007865496.1| gi|229582302|ref|YP_002840701.1| gi|385773116|ref|YP_005645682.1| gi|284997549|ref|YP_003419316.1| gi|238619595|ref|YP_002914420.1| gi|227830132|ref|YP_002831911.1| WP_012711182.1.100559 WP_012711182.1.13477 WP_012711182.1.27011 WP_012711182.1.27461 WP_012711182.1.34992 WP_012711182.1.44962 WP_012711182.1.47130 WP_012711182.1.48461 WP_012711182.1.52267 WP_012711182.1.60638 WP_012711182.1.66823 WP_012711182.1.67233 WP_012711182.1.68242 WP_012711182.1.74483 WP_012711182.1.83431 WP_012711182.1.84481 WP_012711182.1.89621 WP_012711182.1.90709 WP_012711182.1.91160 WP_012711182.1.97021 gi|229578945|ref|YP_002837343.1| gi|385775745|ref|YP_005648313.1| 419942.YN1551_1697 426118.M164_1148 427317.M1425_1158 427318.M1627_1222 429572.LS215_1255 439386.YG5714_1154 gi|227827439|ref|YP_002829218.1| gi|229584654|ref|YP_002843155.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]