SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M9WGK2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M9WGK2
Domain Number 1 Region: 174-703
Classification Level Classification E-value
Superfamily PFL-like glycyl radical enzymes 1.89e-174
Family R1 subunit of ribonucleotide reductase, C-terminal domain 0.0000000000312
Further Details:      
 
Domain Number 2 Region: 14-173
Classification Level Classification E-value
Superfamily R1 subunit of ribonucleotide reductase, N-terminal domain 2.62e-55
Family R1 subunit of ribonucleotide reductase, N-terminal domain 0.0000294
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M9WGK2
Sequence length 719
Comment (tr|M9WGK2|M9WGK2_9MOLU) Ribonucleoside-diphosphate reductase {ECO:0000256|RuleBase:RU003410} KW=Complete proteome; Reference proteome OX=1292033 OS=Mycoplasma putrefaciens Mput9231. GN=MPUT9231_0580 OC=Bacteria; Tenericutes; Mollicutes; Mycoplasmataceae; Mycoplasma.
Sequence
MKDSKELILDDSNDEYIKLNARSKIFAKGQDNFKLDVQAAKSYITNHIEPRLMQFDDLKQ
RIDYLVANEYYDKQILDKYQFEEITELDDYAKSFNHSFPSFMGALKFFNAYALKTFDGEK
YLETYTDRALMNALFLGNGSYQKAKNILKNIMLGRFQPATPTFLNAGKKHRGEYVSCYLL
RTEDNMESICRTISTSLQLSKRGGGVAVCLTNLRETGSPIKNIDGLSSGPIPVMKILEDS
FTYADQLGQRQGAGAVYISAHHPDIISFLDTKRENADEKIRIKSLSLGVVIPDITFELAR
ENKEMALFSPYDVQKVYGVALSDISITEKYYEMLENPNIKKTFISARKLFLTIAELHFES
GYPYLLFEDTVNRRNAHDKKGRIIMSNLCSEIVQVSTPSQYNQDLSFTKIGEDICCNLGS
LNIDKMMKAGKEFEEAVDISITALDVVSRNSDLDCAPSIKFGNANNHAVGLGAMNLHGFL
ATNAIMYDSPEAVDFTNIFFYTLAYNAFKASNRLAKEFGKFNSFDESRFADGSWFEKYTK
CQADKWTPATKKVEELFKHYQVEIPTQTQWIELVEEIKKTGLANSHLMAVAPTGSISYLS
SCTPSLQPVVSTVEVRKEGKLGRVYVPAYQINFDNMGYYAVGAYEMGPDPIINIAAAAQQ
HVDQAISLTLFMTDKATTRDLNRAYINAFKQGCASIYYVRIRQDVLEDSENYECDACKI
Download sequence
Identical sequences M9WGK2
gi|482887554|ref|YP_007884724.1| WP_014035358.1.288 WP_014035358.1.54435 gi|344205365|ref|YP_004790507.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]