SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for N0AM93 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  N0AM93
Domain Number 1 Region: 3-104
Classification Level Classification E-value
Superfamily Hypothetical protein YfhH 1.7e-45
Family Hypothetical protein YfhH 0.0000259
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) N0AM93
Sequence length 109
Comment (tr|N0AM93|N0AM93_9BACI) Uncharacterized protein {ECO:0000313|EMBL:AGK52444.1} KW=Complete proteome; Reference proteome OX=666686 OS=Bacillus sp. 1NLA3E. GN=B1NLA3E_03340 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MQQEKRYSNLNEFELRQEIATLNEKAKKAEQLGMVNEYAVLERKVVMAKAYLLNPEDFLP
GEIYEIIGDPGAYFKVDYLNGVFAWGYRLNGDGKEEALPISMLKIEARN
Download sequence
Identical sequences N0AM93
gi|488571144|ref|YP_007908943.1| WP_015592507.1.96367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]