SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for N0ATK4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  N0ATK4
Domain Number 1 Region: 135-294
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 2.62e-41
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0000725
Further Details:      
 
Domain Number 2 Region: 391-525
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 5.89e-30
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00012
Further Details:      
 
Domain Number 3 Region: 18-134
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.64e-28
Family Duplicated SiR/NiR-like domains 1 and 3 0.00072
Further Details:      
 
Domain Number 4 Region: 270-401
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.13e-23
Family Duplicated SiR/NiR-like domains 1 and 3 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) N0ATK4
Sequence length 539
Comment (tr|N0ATK4|N0ATK4_9BACI) Ferredoxin--nitrite reductase {ECO:0000313|EMBL:AGK53347.1} KW=Complete proteome; Reference proteome OX=666686 OS=Bacillus sp. 1NLA3E. GN=B1NLA3E_07925 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MAYEKIWADNPVLNKTELRKLQKDALRIFDDIPYYAQNGFSSIPTEEWDMFKWAGLYLQK
PKEDGYFMMRVCVPSGVLTNEQAIVLANIAKDYGRGVYDFTTRQAIQFHWLTIDQIPDIY
SRLESVGLSTAGACGDITRNIVGNSLAGIDPNELFDTRPIVKEVYDFFQFNEDFSNLPRK
FKISISSNVNNASNSEINCLSFVPAYKEINGERVAGFNVKVGGGLSAVPYLAETLDIFVT
TDKTLEVAIAITTLYRDHGYREKRHRARLKFLIADWGVEKFKEKLIELTGPLPEKGEDAQ
KDWNAGYFYGVHQQKQAGLNYIGANIPVGRLTPEDVIEFARISKKYGDGEIRNCNSQNIV
IPNIPDENVDAILKEAIFTKFPIAPNKIVGYAVSCTGSEYCNLALVETKNRMKTIAEQLD
EEISLDVPVRIHMVGCPNSCGQRNIADLGLHGVKSRNQDKKLVEAFEIYVGGTLNKEAKF
NEKLKGKVEADHLKQVVKELLQSFQDTKLPGELYADYVNRVGKDFIQEKLDSILSSVTV
Download sequence
Identical sequences N0ATK4
WP_015593407.1.96367 gi|488572047|ref|YP_007909846.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]