SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for N0BID0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  N0BID0
Domain Number 1 Region: 1-107
Classification Level Classification E-value
Superfamily GlnB-like 6.04e-39
Family Prokaryotic signal transducing protein 0.0000515
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) N0BID0
Sequence length 110
Comment (tr|N0BID0|N0BID0_9EURY) Nitrogen regulatory protein P-II family {ECO:0000313|EMBL:AGK62037.1} KW=Complete proteome; Reference proteome OX=387631 OS=Archaeoglobus sulfaticallidus PM70-1. GN=Asulf_02077 OC=Archaeoglobaceae; Archaeoglobus.
Sequence
MKKIEAIIRPEKLECVKKALEESGYVAMTVTEVKGRGEQKGIKLQFRGREVDVDFLQKTK
IEIVAEDKDVDRIIDIITSSARTGKYGDGRIFVLPVEKSVKIRTGEEVSE
Download sequence
Identical sequences N0BID0
WP_015591633.1.93643 gi|488601559|ref|YP_007908030.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]