SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for N0CQT1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  N0CQT1
Domain Number 1 Region: 144-261
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.17e-16
Family N-acetyl transferase, NAT 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) N0CQT1
Sequence length 265
Comment (tr|N0CQT1|N0CQT1_9ACTN) Uncharacterized protein {ECO:0000313|EMBL:AGK77299.1} KW=Complete proteome OX=1303692 OS=Streptomyces fulvissimus DSM 40593. GN=SFUL_2345 OC=Streptomyces.
Sequence
MTSLARHQLSPAETGPALRALCEWTPADAPAGGLHPGDVGWLLRLDDAAVHLWTDGEVPV
AVGFLDGPVLRVTATPDADHGALAADAEELLVPGNDWSDGLPVPGWVPEQEESWLVLSWT
PRPVVSRAEPVGAAMTADRVLVHREAFAGSTFTVERHRTMMRSPAAGLACETLVRTPAGE
PAAAATGWFAGEGRCGLLEPVGTHADHRGHGYGRDAVLGTCAALARRGASAVAVMTPSAN
EAAVALYRSAGFTVVRENRDWARPR
Download sequence
Identical sequences N0CQT1
WP_015608665.1.90088 gi|488609848|ref|YP_007931184.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]