SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for N0CX92 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  N0CX92
Domain Number 1 Region: 1-173
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 3.99e-40
Family N-acetyl transferase, NAT 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) N0CX92
Sequence length 203
Comment (tr|N0CX92|N0CX92_9ACTN) Uncharacterized protein {ECO:0000313|EMBL:AGK77547.1} KW=Complete proteome OX=1303692 OS=Streptomyces fulvissimus DSM 40593. GN=SFUL_2600 OC=Streptomyces.
Sequence
MEPITLTTRRLLLRPFGPQDTYRVHAACQDPDIQRWTVIPSPYRLTDAELFTAKLSPAGW
RDDSAYSFALALRETGTLVGALSIDRRSRPGTYEVGYWSTKEHRGQGYVTEAVLGSARWA
FTALGADRLEWRAEIGNLASRAVALRAGFRLEGDQRSGLLNKGVRRDAWSGALLPSDLEL
PGTHPYLPERHAGRPGTATDSPR
Download sequence
Identical sequences A0A233SL81 N0CX92
WP_015608912.1.1363 WP_015608912.1.14758 WP_015608912.1.6102 WP_015608912.1.90088 gi|488610096|ref|YP_007931432.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]