SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for N0CZ24 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  N0CZ24
Domain Number 1 Region: 5-138
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 2.87e-22
Family N-acetyl transferase, NAT 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) N0CZ24
Sequence length 174
Comment (tr|N0CZ24|N0CZ24_9ACTN) Uncharacterized protein {ECO:0000313|EMBL:AGK78247.1} KW=Complete proteome OX=1303692 OS=Streptomyces fulvissimus DSM 40593. GN=SFUL_3316 OC=Streptomyces.
Sequence
MSAVMNLTLTDLAPDDPRMSADIAPLIRTLRPQLTAPAFAAFAEEAYGQGLRFTVAYDAT
GRVLGVATHRLLATSRGRVLFVDDLVTAPESRGRGVGAHLLAELERRARAAGCARVELDS
GTANVHAHRFYHARRMTIGALHFGLDIAPDTAPDTPPVTPPDTPPVTAPDIAPE
Download sequence
Identical sequences N0CZ24
gi|488610796|ref|YP_007932132.1| WP_015609602.1.90088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]