SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for N1QN56 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  N1QN56
Domain Number 1 Region: 122-486
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 4.02e-92
Family Glutamine synthetase catalytic domain 0.0000472
Further Details:      
 
Weak hits

Sequence:  N1QN56
Domain Number - Region: 14-117
Classification Level Classification E-value
Superfamily Glutamine synthetase, N-terminal domain 0.011
Family Glutamine synthetase, N-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) N1QN56
Sequence length 488
Comment (tr|N1QN56|N1QN56_SPHMS) Glutamine synthetase/guanido kinase {ECO:0000313|EMBL:EMF17902.1} KW=Complete proteome; Reference proteome OX=692275 OS=(Septoria musiva). GN=SEPMUDRAFT_146813 OC=Sphaerulina.
Sequence
MANAKEPSELKHEDLEELLKDDDAIKVGGVDIDGQVRGKLMSKKKFMSIVASGFGFCSVI
FGWDMHDQTYFKELAISNAANGYRDITAEVDVSSFRRIPWENNVPFFLVSFREPEGEKLI
ACPRSLLETAVEKIEASGIGALAGAEYEFFTFRAPSDPSANERNSSATVTFLKNNPVNSL
PSLEEGMFGYSLTRPTHNQKWYYDIFETCKKFRCNIEGWHTESGPGVYEAALEYGEIRQM
ADRAALFKLVVKNTSSKYGITPCFMAKPREGLPGNSGHMHVSLVDHKTGKNLFHREEKDE
NPPYADVAHVSDIGRSFLAGVLEGLPDIMPLVAPTVNSYKRLVENFWAPVTVSWGLEHRA
ASVRLIAPPTCPPKGTRLEIRVPGADTNAYLVLAAILALGWRGVEKKLAIPVPPLGKGQD
VGGEADKGQRLAKSLKEATATFARPGSIAREVLGDAFVDHYAGTREHEVRLWDEAVTDWE
VKRYIETV
Download sequence
Identical sequences N1QN56
jgi|Sepmu1|146813|estExt_fgenesh1_kg.C_1_t30403 XP_016766023.1.6424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]