SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for N1QQ31 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  N1QQ31
Domain Number - Region: 130-179
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00216
Family B3 DNA binding domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) N1QQ31
Sequence length 231
Comment (tr|N1QQ31|N1QQ31_AEGTA) Uncharacterized protein {ECO:0000313|EMBL:EMT00943.1, ECO:0000313|EnsemblPlants:EMT00943} OX=37682 OS=Aegilops tauschii (Tausch's goatgrass) (Aegilops squarrosa). GN=F775_24714 OC=Pooideae; Triticodae; Triticeae; Triticinae; Aegilops.
Sequence
MTPAVGCLETTPADGDRVGFDLFIFPLCESESPFHMAPEPDDRSYPDAGDPLFAGRQIHG
GASEADLMGHSIIPNNEHIPDAATDPKYGTHWINNASATLRGVNTCAYGPALNPDVPTDD
SENIIVVPGWKKRRILLHDDTGAHVGASYKKANDGRLVMQGGFRKYVDQLELKEDDLVVH
GCTLDCCNMCQAHFLSCEFANPMIDNISELRQMKLLQNVPSIARTRSLPIP
Download sequence
Identical sequences N1QQ31
EMT00943

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]