SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for N1QSY8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  N1QSY8
Domain Number 1 Region: 503-610
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000000011
Family B3 DNA binding domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) N1QSY8
Sequence length 640
Comment (tr|N1QSY8|N1QSY8_AEGTA) B3 domain-containing protein {ECO:0000313|EMBL:EMT01811.1, ECO:0000313|EnsemblPlants:EMT01811} OX=37682 OS=Aegilops tauschii (Tausch's goatgrass) (Aegilops squarrosa). GN=F775_01649 OC=Pooideae; Triticodae; Triticeae; Triticinae; Aegilops.
Sequence
MRRSKGSGRRRAADERKLIRMADEAAAASSMQAAAAAALASLHLPPPGLTETDNQDRKIF
GRGARIKRKAKRKWGYVGAEAGAVDSGGLRPRLLSHRRSTCRGGVGSMDEVLHGEVGIRS
RFSAGRIREIMRGLTPRQQGYVAKYGFEHFNRIGAFSVHEPLTEWIMGKINPPFSEFRIN
ADKTIVFSKPLVQKILGVPTGGRPFVLHGQKSDKIKELRDLYLNNGLRATIPHCVSLLKN
NEDEESFMRTFLLLAAVLTPTTGNTIDLDYLWAFEDMSKVQDLDWAGHITEHLMDEVQKF
QYKSREEKMRDFWVGGCLPLLTIAYMDHLDLPRGRIVDHEINYSVPRICHVSKDDFQFAA
IADLHRQHFKFATFGILPFRDRTPYTDNPVTDTEVAEDDLRILSNDQVLSGQWELVEVHE
QKIDELVKETQPEALGFAEASIDHFRLGRTDISSNQVEDSGREYESSESDDHPTPPEADY
GVIFRSYLSGTQMESVNTLIHKIKPETIVFVATMRKSDVQLPTPLLIISKERSLAAAARF
PHENGAVTLQMPGKSEKWRPRFFIEKDNCMLAGNWLDFVCDNQVQAGDICIFVPAMGGER
STFTVHIIRAEATHQRGVKRVRSSHDSPVGVEGMTNPDAV
Download sequence
Identical sequences N1QSY8
EMT01811

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]