SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for N1QY14 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  N1QY14
Domain Number 1 Region: 4-132
Classification Level Classification E-value
Superfamily PapD-like 3.66e-37
Family MSP-like 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) N1QY14
Sequence length 295
Comment (tr|N1QY14|N1QY14_AEGTA) Vesicle-associated membrane protein-associated protein A {ECO:0000313|EMBL:EMT15755.1, ECO:0000313|EnsemblPlants:EMT15755} OX=37682 OS=Aegilops tauschii (Tausch's goatgrass) (Aegilops squarrosa). GN=F775_20454 OC=Pooideae; Triticodae; Triticeae; Triticinae; Aegilops.
Sequence
MVGGALISVYPDDLTFLFELDKPCYCNLKVVNNSEHHVAFKVKTTSPRKYFVRPNASVVQ
PWDSCTITITLQSQKEYPPDMQSKDKFLIQSTRVAASTDMDEIPPDTFNKEADKVIEEMK
LKVVYTLPSGSSDDSGVTSSANRSFKQGGDDLSMLKNASIEESCKYYFSLRFLNAEANTR
YLFLYKIMKRANMGNRTMFKHHQIIVEISVKLVEREKRYLYFQAGVIIEVGRDAQKPIQT
IQRLKDERDNNLQQNQQMQRELVLYIDLFTLHVVSTHCFSSVQLLVCLSILTFGF
Download sequence
Identical sequences N1QY14
EMT15755

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]