SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for N1QYK1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  N1QYK1
Domain Number 1 Region: 121-226
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.05e-36
Family B3 DNA binding domain 0.0046
Further Details:      
 
Domain Number 2 Region: 955-1020
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000265
Family PB1 domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) N1QYK1
Sequence length 1074
Comment (tr|N1QYK1|N1QYK1_AEGTA) Auxin response factor {ECO:0000256|RuleBase:RU004561} OX=37682 OS=Aegilops tauschii (Tausch's goatgrass) (Aegilops squarrosa). GN=F775_09095 OC=Pooideae; Triticodae; Triticeae; Triticinae; Aegilops.
Sequence
MAQSPASSAVAAPAPCEGERKAPAINGELWHACAGPLVSLPPVGSLVVYFPQGHSEQVAA
SMQKDVEAHVPSYPNLPSKLICLLHSVTLQADPDTDEVYAQMTLQPVNTYAKEALQLSEL
ALRQARPQMEFFCKTLTASDTSTHGGFSVPRRAAEKIFPSLDFSLQPPCQELQARDIHDN
VWTFRHIFRGQPKRHLLTTGWSLFVSGKKLFAGDSVIFVRASPTEFVIPFAKYQKAMYSN
QISLGMRFRMMCETEELGTRRYMGTITGISDLDPVRWKNSQWRSLQVGWDESAAGERRNR
VSIWEIEPLAAPFFICPQPFFGVKRPRQLDDESLEMESLMKRAMPWLGEEICIKDPQTQS
ATMPGLSLVQWMNMNRQQSSSLASTAMQSEYLRSASNPAMQNIGAADLARQLYMQNHLLQ
QNSMQFNPPKLHQQMKPINDLSNAALPLNQLGAIRNHQDQKQDQQRQQQSGIQAIPLSQA
QAQTNIVQAQVILQNQMQQQQQQKQPPPSPTQNQHGASGQHLLQSHQLQDQNLQMQQQQL
LLHQQLQQQQQLNKLPGQLANLASQQTQLSDQELHLQLLQKLQQQSLMSQSAVTLSRLPI
IQEQQNFLVDMQQQLSNSHSLAQQQVMPQQDCRTSSSQTTQLPPPIQQEQQQQKPSQKQV
APTYVSEAAFAQISSTSVIPKTGNSMIVPGAAQSAVTEEIPSCSTSPSTANGNHLVQPTI
GRNDHCKISTEKVPHSIAQMSILTPIEAVSVTPVTTKELPKLNNGVKSSAITSKLPNVVS
GLQNFMNNALPTDNLETASSATSLWPSQTDGLLHQGFATSNFNQHQMFKDELPDVEIQGV
DPSNSALFGMNNDGPLGFPMETEGLLENALDSVKYQNHFSTDDENNYQMQKDARQEISTS
MVSQSFGQSDMAFNSIDSAINDGALMNRSSWPPAAPPQRMRTFTKVYKRGAVGRSIDIGR
FSGYGELNQALARMFGIEGQLEDRQRIGWKLVYTDHEDDVLLLGDDPWEEFVNCVKCIRI
LSPQEVQKMSLDGDLGSNVLPNQACSSSDGGNTWKPRYEQNSGNPSIGPYDQFE
Download sequence
Identical sequences N1QYK1
EMT16165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]