SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for N4X3Q4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  N4X3Q4
Domain Number 1 Region: 2-262
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.22e-84
Family Capz beta-1 subunit 0.0000000953
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) N4X3Q4
Sequence length 265
Comment (tr|N4X3Q4|N4X3Q4_COCH4) Uncharacterized protein {ECO:0000313|EMBL:ENI01211.1} KW=Complete proteome OX=665024 OS=(Southern corn leaf blight fungus) (Bipolaris maydis). GN=COCC4DRAFT_204506 OC=Pleosporaceae; Bipolaris.
Sequence
MADPIDSALDLLRRLDPKDVKRNVDHIIQLNPSLEEDLLESVDIPLTVKKCSKTKRDFLC
CDYNRDGDSWRSPWSNEFEPPIDEGVTPSDRVRKMEVKANEAFDVYRELYFEGGISSVYL
WDMDDGFAGCVLLKKSVSPTPKSSGSWDSIHVFDAQDRARTSHYKLTSTVILSLGTDSEA
LGGLDLSGNMVRQVEADMAVEDDTSHVANIGKMVEDMELKMRNLLQEVYFGKAKDVVGDL
RSLQSLSQANKDRATQREMINSMGR
Download sequence
Identical sequences M2SXC2 M2V342 N4X3Q4
jgi|CocheC5_1|82306|estExt_Genewise1.C_30989 XP_007696487.1.66866 XP_014075120.1.79200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]