SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for O00213 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  O00213
Domain Number 1 Region: 528-660
Classification Level Classification E-value
Superfamily PH domain-like 1.35e-35
Family Phosphotyrosine-binding domain (PTB) 0.0000107
Further Details:      
 
Domain Number 2 Region: 335-505
Classification Level Classification E-value
Superfamily PH domain-like 3.38e-34
Family Phosphotyrosine-binding domain (PTB) 0.0066
Further Details:      
 
Domain Number 3 Region: 243-284
Classification Level Classification E-value
Superfamily WW domain 0.000000000117
Family WW domain 0.0000682
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) O00213
Sequence length 710
Comment (sp|O00213|APBB1_HUMAN) Protein Fe65 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=APBB1; OC=Catarrhini; Hominidae; Homo.
Sequence
MSVPSSLSQSAINANSHGGPALSLPLPLHAAHNQLLNAKLQATAVGPKDLRSAMGEGGGP
EPGPANAKWLKEGQNQLRRAATAHRDQNRNVTLTLAEEASQEPEMAPLGPKGLIHLYSEL
ELSAHNAANRGLRGPGLIISTQEQGPDEGEEKAAGEAEEEEEDDDDEEEEEDLSSPPGLP
EPLESVEAPPRPQALTDGPREHSKSASLLFGMRNSAASDEDSSWATLSQGSPSYGSPEDT
DSFWNPNAFETDSDLPAGWMRVQDTSGTYYWHIPTGTTQWEPPGRASPSQGSSPQEESQL
TWTGFAHGEGFEDGEFWKDEPSDEAPMELGLKEPEEGTLTFPAQSLSPEPLPQEEEKLPP
RNTNPGIKCFAVRSLGWVEMTEEELAPGRSSVAVNNCIRQLSYHKNNLHDPMSGGWGEGK
DLLLQLEDETLKLVEPQSQALLHAQPIISIRVWGVGRDSGRERDFAYVARDKLTQMLKCH
VFRCEAPAKNIATSLHEICSKIMAERRNARCLVNGLSLDHSKLVDVPFQVEFPAPKNELV
QKFQVYYLGNVPVAKPVGVDVINGALESVLSSSSREQWTPSHVSVAPATLTILHQQTEAV
LGECRVRFLSFLAVGRDVHTFAFIMAAGPASFCCHMFWCEPNAASLSEAVQAACMLRYQK
CLDARSQASTSCLPAPPAESVARRVGWTVRRGVQSLWGSLKPKRLGAHTP
Download sequence
Identical sequences O00213
NP_001155.1.87134 NP_001155.1.92137 ENSP00000477213 HR3621 gi|4502131|ref|NP_001155.1| ENSP00000477213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]