SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for O14924 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  O14924
Domain Number 1 Region: 691-837
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.83e-40
Family Regulator of G-protein signaling, RGS 0.0001
Further Details:      
 
Domain Number 2 Region: 1017-1115
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.13e-29
Family Ras-binding domain, RBD 0.00095
Further Details:      
 
Domain Number 3 Region: 215-372
Classification Level Classification E-value
Superfamily PH domain-like 1.72e-22
Family Phosphotyrosine-binding domain (PTB) 0.013
Further Details:      
 
Domain Number 4 Region: 9-104
Classification Level Classification E-value
Superfamily PDZ domain-like 1.1e-20
Family PDZ domain 0.01
Further Details:      
 
Domain Number 5 Region: 962-1031
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000000189
Family Ras-binding domain, RBD 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) O14924
Sequence length 1447
Comment (sp|O14924|RGS12_HUMAN) Regulator of G-protein signaling 12 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=RGS12; OC=Catarrhini; Hominidae; Homo.
Sequence
MFRAGEASKRPLPGPSPPRVRSVEVARGRAGYGFTLSGQAPCVLSCVMRGSPADFVGLRA
GDQILAVNEINVKKASHEDVVKLIGKCSGVLHMVIAEGVGRFESCSSDEEGGLYEGKGWL
KPKLDSKALGINRAERVVEEMQSGGIFNMIFENPSLCASNSEPLKLKQRSLSESAATRFD
VGHESINNPNPNMLSKEEISKVIHDDSVFSIGLESHDDFALDASILNVAMIVGYLGSIEL
PSTSSNLESDSLQAIRGCMRRLRAEQKIHSLVTMKIMHDCVQLSTDKAGVVAEYPAEKLA
FSAVCPDDRRFFGLVTMQTNDDGSLAQEEEGALRTSCHVFMVDPDLFNHKIHQGIARRFG
FECTADPDTNGCLEFPASSLPVLQFISVLYRDMGELIEGMRARAFLDGDADAHQNNSTSS
NSDSGIGNFHQEEKSNRVLVVDLGGSSSRHGPGGSAWDGVGGRGAQPWGAPWTGPFCPDP
EGSPPFEAAHQTDRFWDLNKHLGPASPVEVPPASLRSSVPPSKRGTVGAGCGFNQRWLPV
HVLREWQCGHTSDQDSYTDSTDGWSSINCGTLPPPMSKIPADRYRVEGSFAQPPLNAPKR
EWSRKAFGMQSIFGPHRNVRKTKEDKKGSKFGRGTGLTQPSQRTSARRSFGRSKRFSITR
SLDDLESATVSDGELTGADLKDCVSNNSLSSNASLPSVQSCRRLRERRVASWAVSFERLL
QDPVGVRYFSDFLRKEFSEENILFWQACEYFNHVPAHDKKELSYRAREIFSKFLCSKATT
PVNIDSQAQLADDVLRAPHPDMFKEQQLQIFNLMKFDSYTRFLKSPLYQECILAEVEGRA
LPDSQQVPSSPASKHSLGSDHSSVSTPKKLSGKSKSGRSLNEELGDEDSEKKRKGAFFSW
SRTRSTGRSQKKREHGDHADDALHANGGLCRRESQGSVSSAGSLDLSEACRTLAPEKDKA
TKHCCIHLPDGTSCVVAVKAGFSIKDILSGLCERHGINGAAADLFLVGGDKPLVLHQDSS
ILESRDLRLEKRTLFRLDLVPINRSVGLKAKPTKPVTEVLRPVVARYGLDLSGLLVRLSG
EKEPLDLGAPISSLDGQRVVLEEKDPSRGKASADKQKGVPVKQNTAVNSSSRNHSATGEE
RTLGKSNSIKIKGENGKNARDPRLSKREESIAKIGKKKYQKINLDEAEEFFELISKAQSN
RADDQRGLLRKEDLVLPEFLRLPPGSTELTLPTPAAVAKGFSKRSATGNGRESASQPGEQ
WEPVQESSDSPSTSPGSASSPPGPPGTTPPGQKSPSGPFCTPQSPVSLAQEGTAQIWKRQ
SQEVEAGGIQTVEDEHVAELTLMGEGDISSPNSTLLPPPSTPQEVPGPSRPGSGTHGSRD
LPVNRIIDVDLVTGSAPGRDGGIAGAQAGPGRSQASGGPPTSDLPGLGPVPGEPAKPKTS
AHHATFV
Download sequence
Identical sequences O14924
9606.ENSP00000339381 HR3474 ENSP00000338509 NP_937872.1.87134 NP_937872.1.92137 XP_006713968.1.92137 XP_016864018.1.92137 gi|38327601|ref|NP_937872.1| ENSP00000338509 ENSP00000339381 ENSP00000339381

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]