SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for O24701 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  O24701
Domain Number 1 Region: 3-177
Classification Level Classification E-value
Superfamily RL5-like 1.55e-71
Family Ribosomal protein L5 0.000000501
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) O24701
Sequence length 179
Comment (sp|O24701|RL5_SYNP6) 50S ribosomal protein L5 {ECO:0000255|HAMAP-Rule:MF_01333} KW=Complete proteome OX=269084 OS=(Anacystis nidulans). GN=syc1877_d; OC=Synechococcus.
Sequence
MSLKTKYRDIIVPKLMKEFGYTNIHQVPKVVKVTINRGLGEGAQNAKALESSLAEIAKIA
GQKPVVTRAKKAIAGFKIRAGMPVGLMVTLRGDRRDAFLERLINLSLPRIRDFRGISPRS
FDGRGNYTLGLREQLIFPEITYDSIDQIRGMDITIVTSANSDEEGRALLRELGMPFREN
Download sequence
Identical sequences O24701 Q31L19
WP_011244187.1.45845 WP_011244187.1.5740 WP_011244187.1.95485 gi|56751886|ref|YP_172587.1| 1140.Synpcc7942_2220 269084.syc1877_d gi|81301029|ref|YP_401237.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]