SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for O43147 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  O43147
Domain Number 1 Region: 542-605,780-899
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.94e-40
Family Ypt/Rab-GAP domain of gyp1p 0.0077
Further Details:      
 
Domain Number 2 Region: 8-96,123-200
Classification Level Classification E-value
Superfamily RUN domain-like 2.22e-33
Family RUN domain 0.0015
Further Details:      
 
Domain Number 3 Region: 875-998
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.88e-26
Family Ypt/Rab-GAP domain of gyp1p 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) O43147
Sequence length 1006
Comment (sp|O43147|SGSM2_HUMAN) RUN and TBC1 domain-containing protein 1 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=SGSM2; OC=Catarrhini; Hominidae; Homo.
Sequence
MGSAEDAVKEKLLWNVKKEVKQIMEEAVTRKFVHEDSSHIIALCGAVEACLLHQLRRRAA
GFLRSDKMAALFTKVGKTCPVAGEICHKVQELQQQAEGRKPSGVSQEALRRQGSASGKAP
ALSPQALKHVWVRTALIEKVLDKVVQYLAENCSKYYEKEALLADPVFGPILASLLVGPCA
LEYTKLKTADHYWTDPSADELVQRHRIRGPPTRQDSPAKRPALGIRKRHSSGSASEDRLA
ACARECVESLHQNSRTRLLYGKNHVLVQPKEDMEAVPGYLSLHQSAESLTLKWTPNQLMN
GTLGDSELEKSVYWDYALVVPFSQVVCIHCHQQKSGGTLVLVSQDGIQRPPLHFPQGGHL
LSFLSCLENGLLPRGQLEPPLWTQQGKGKVFPKLRKRSSIRSVDMEEMGTGRATDYVFRI
IYPGHRHEHNAGDMIEMQGFGPSLPAWHLEPLCSQGSSCLSCSSSSSPHATPSHCSCIPD
RLPLRLLCESMKRQIVSRAFYGWLAHCRHLSTVRTHLSALVHHSVIPPDRPPGASAGLTK
DVWSKYQKDKKNYKELELLRQVYYGGIEHEIRKDVWPFLLGHYKFGMSKKEMEQVDAVVA
ARYQQVLAEWKACEVVVRQREREAHPATRTKFSSGSSIDSHVQRLIHRDSTISNDVFISV
DDLEPPEPQDPEDSRPKPEQEAGPGTPGTAVVEQQHSVEFDSPDSGLPSSRNYSVASGIQ
SSLDEGQSVGFEEEDGGGEEGSSGPGPAAHTLREPQDPSQEKPQAGELEAGEELAAVCAA
AYTIELLDTVALNLHRIDKDVQRCDRNYWYFTPPNLERLRDVMCSYVWEHLDVGYVQGMC
DLLAPLLVTLDNDQLAYSCFSHLMKRMSQNFPNGGAMDTHFANMRSLIQILDSELFELMH
QNGDYTHFYFCYRWFLLDFKRELLYEDVFAVWEVIWAARHISSEHFVLFIALALVEAYRE
IIRDNNMDFTDIIKFFNERAEHHDAQEILRIARDLVHKVQMLIENK
Download sequence
Identical sequences B9A6J3 O43147
gi|148612829|ref|NP_001091979.1| NP_001091979.1.87134 NP_001091979.1.92137 ENSP00000415107 ENSP00000415107

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]