SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for O64737 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  O64737
Domain Number 1 Region: 14-156
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.45e-16
Family N-acetyl transferase, NAT 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) O64737
Sequence length 386
Comment (tr|O64737|O64737_ARATH) Hookless1-like protein {ECO:0000313|EMBL:AAC16963.1} KW=Complete proteome; Reference proteome OX=3702 OS=Arabidopsis thaliana (Mouse-ear cress). GN=T27E13.17 OC=Arabidopsis.
Sequence
MVGQWEEEVDEEVVIRCYDDRRDRIQMGRMEKSCEIGHDHQTLLFTDTLGDPICRIRNSP
FFIMLVAGVGNKLVGSIQGSVKPVEFHDKSVRVGYVLGLRVVPSYRRRGIGSILVRKLEE
WFESHNADYAYMATEKDNEASHGLFIGRLGYVVFRNPAILVNPVNPGRGLKLPSDIGIRK
LKVKEAESLYRRNVAATTEFFPDDINKILRNKLSIGTWVAYYNNVDNTRSWAMLSVWDSS
KVFKLRIERAPLSYLLLTKVSKLFGNFLSLLGLTVLPDLFTPFGFYFLYGVHSEGPHCGK
LVRALCEHVHNMAALNDGCACKVVVVEVDKGSNGDDSLQRCIPHWKMLSCDDDMWCIKPL
KCEKNKFDLSERSKSRSSLFVDPREV
Download sequence
Identical sequences O64737
3702.AT2G30090.1-P AT2G30090.1 AT2G30090.1 NP_180570.1.80155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]