SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for O94788 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  O94788
Domain Number 1 Region: 28-513
Classification Level Classification E-value
Superfamily ALDH-like 1.57e-184
Family ALDH-like 0.000000000000018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) O94788
Sequence length 518
Comment (sp|O94788|AL1A2_HUMAN) Retinaldehyde-specific dehydrogenase type 2 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=ALDH1A2; OC=Catarrhini; Hominidae; Homo.
Sequence
MTSSKIEMPGEVKADPAALMASLHLLPSPTPNLEIKYTKIFINNEWQNSESGRVFPVYNP
ATGEQVCEVQEADKADIDKAVQAARLAFSLGSVWRRMDASERGRLLDKLADLVERDRAVL
ATMESLNGGKPFLQAFYVDLQGVIKTFRYYAGWADKIHGMTIPVDGDYFTFTRHEPIGVC
GQIIPWNFPLLMFAWKIAPALCCGNTVVIKPAEQTPLSALYMGALIKEAGFPPGVINILP
GYGPTAGAAIASHIGIDKIAFTGSTEVGKLIQEAAGRSNLKRVTLELGGKSPNIIFADAD
LDYAVEQAHQGVFFNQGQCCTAGSRIFVEESIYEEFVRRSVERAKRRVVGSPFDPTTEQG
PQIDKKQYNKILELIQSGVAEGAKLECGGKGLGRKGFFIEPTVFSNVTDDMRIAKEEIFG
PVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALTVSSAMQAGTVWINCYNALNAQ
SPFGGFKMSGNGREMGEFGLREYSEVKTVTVKIPQKNS
Download sequence
Identical sequences O94788
NP_003879.2.87134 NP_003879.2.92137 ENSP00000249750 gi|25777724|ref|NP_003879.2| ENSP00000249750 9606.ENSP00000249750 ENSP00000249750

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]