SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P0CR52 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  P0CR52
Domain Number - Region: 95-118
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00586
Family Retrovirus zinc finger-like domains 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) P0CR52
Sequence length 574
Comment (sp|P0CR52|SLU7_CRYNJ) Pre-mRNA-splicing factor SLU7 KW=Complete proteome; Reference proteome OX=214684 OS=ATCC MYA-565) (Filobasidiella neoformans). GN=SLU7; OC=Cryptococcus neoformans species complex.
Sequence
MLSTSTSLQGGKVSREEYRRQKDLEAARKAGTAPAALDEQGNAINPHIPEYITKAPWYAD
TGRPSLAHQRINEQGPHLKLDEWYDRGAKAGPAAKKYRKGACENCGAMTHKMKDCVERPR
KRGAKFTNKDIAPDELVQQFEGDYDAKRDRWNGYDPASYKHVVEEYEATEQMRKKYREEE
IDQQTSTDMAVVKKLAKKDKEGKVEDDDDDFGSSDEDEDDEDKYADAADQVGQKLDTKTR
ITVRNLRIREDTAKYLINLDESSAYYDPKTRSMRDAPVRNMNPEDMKFAGDNFQRYSGDA
TNMQKLQLFAWQSAQKGSNINVSANPTAGELLHREFQQKKEVLKDTNKTSILAKYGGEEH
LQRMPNELLSGQTENYVEYSRSGQIIKGRERAKARSKYDEDVYINNHTAIWGSYYDLSTS
QWGFACCHSVLPGSYCTGDAGKLANAASSASALLASSNERSKIEEAAEKERESLAEQHLK
DLASGKAKKGKEREWDLPQYAKRREDGEELDLDKGRLKNALKEEKKRKKMGEDEAWQQTK
KGKTDVTQEELEAYRLSRQAYDDPMSNYQDPEDQ
Download sequence
Identical sequences P0CR52 P0CR53
214684.CND02870 163.m06198 XP_570464.1.95466 XP_775942.1.65578 sgtc|cn04355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]