SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P0CW46 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P0CW46
Domain Number 1 Region: 1-121
Classification Level Classification E-value
Superfamily GlnB-like 2.64e-31
Family Prokaryotic signal transducing protein 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) P0CW46
Sequence length 121
Comment (sp|P0CW46|GLNB2_METMI) Nitrogen fixation nifHD region glnB-like protein 2 OX=39152 OS=Methanococcus maripaludis (Methanococcus deltae). GN=glnBII; OC=Methanococcaceae; Methanococcus.
Sequence
MKEIIAIIRPSKMAQTKTVLEGLGFPAMTANRVLGRGKQKAIVGELGFEVDNKELLNQPG
DMRYIPKTMLTLIVPDEDASLVVEAIMKVNKSGQYGDGKIFVCPIEDIITVRTSERGEAA
I
Download sequence
Identical sequences G0GZY2 P0CW46 P0CW47
267377.MMP0855 gi|340624153|ref|YP_004742606.1| WP_011170799.1.40991 WP_011170799.1.41672 gi|45358418|ref|NP_987975.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]