SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P12754 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P12754
Domain Number 1 Region: 269-554,596-647
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 3.23e-86
Family IF2B-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) P12754
Sequence length 651
Comment (sp|P12754|EI2BD_YEAST) eIF-2B GDP-GTP exchange factor subunit delta KW=Complete proteome; Reference proteome OX=559292 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). GN=GCD2; OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MSESEAKSRSATPPSKAKQATPTTTAAANGEKKLTNKELKELKKQEKAAKRAAMKQANGI
SIEQQQQQAQMKKEKKQLQREQQQKREQKQKNANKKKQNERNVKKSTLFGHLETTEERRA
TILALTSAVSSPKTSRITAAGLMVPVVASALSGSNVLTASSLMPVGPNASSTVSASAPAS
TTTTLPASSAALSAGTSSASTNTPTAIQQEIASSNASDVAKTLASISLEAGEFNVIPGIS
SVIPTVLEQSFDNSSLISSVKELLLNKDLIHPSILLLTSHLAHYKIVGSIPRCIAMLEVF
QIVIKDYQTPKGTTLSRNLTSYLSHQIDLLKKARPLSVTMGNAIRWLKQEISLIDPSTPD
KAAKKDLCEKIGQFAKEKIELADQLIIDNASTQIEESTTIVTYGSSKVLTELLLHNAISL
KKNIKVIVVDSRPLFEGRKMAETLRNAGVNVMYALITSLDTIFNMDVDYVFLGAHSILSN
GFLYSRAGTAMLAMSAKRRNIPVLVCCESLKFSQRVQLDSVTFNELADPNDLVNIDYENP
VERRGNKGALLNQFIKERKFEKKKLAMENKPKGNKIGGKKGSEGESKDASNEEDSNSKNI
LDGWQELPSLNIVNILYDLTPPEYIKKVITEFGALPPSSVPVILREYKGSA
Download sequence
Identical sequences A0A0L8VQE5 B3LIE3 B5VJ27 E7KNQ3 P12754
YGR083C YGR083C YGR083C NP_011597.1.97178 SCRT_00934 4932.YGR083C YGR083C YGR083C YGR083C YGR083C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]