SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P16213 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P16213
Domain Number 1 Region: 22-117
Classification Level Classification E-value
Superfamily Immunoglobulin 1.38e-22
Family C1 set domains (antibody constant domain-like) 0.00000653
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) P16213
Sequence length 119
Comment (sp|P16213|B2MG_PONPY) Beta-2-microglobulin OX=9600 OS=Pongo pygmaeus (Bornean orangutan). GN=B2M; OC=Catarrhini; Hominidae; Pongo.
Sequence
MSRSVALAVLALLSLSGLEAIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLL
KNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM
Download sequence
Identical sequences A0A2J8NTN7 P16213 P61769 P61770 P61771
3jts_B 3jts_E 3jts_H 4wwk_D 5bxf_B 5bxf_D 5j1a_B 5whk_B 6at5_B NYSGRC-IgSF-B2MG_HUMAN ENSP00000452780 ENSP00000453191 ENSP00000453350 ENSP00000481426 NP_001009066.1.37143 NP_004039.1.87134 NP_004039.1.92137 WP_073668312.1.37512 XP_004056148.1.27298 XP_008962051.1.60992 XP_019295877.1.44245 ENSP00000452780 ENSP00000453191 ENSP00000453350 ENSGGOP00000026553 gi|4757826|ref|NP_004039.1| ENSPTRP00000011997 ENSPTRP00000011997 9598.ENSPTRP00000011997 9606.ENSP00000340858

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]