SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P19010 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P19010
Domain Number 1 Region: 24-71
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 0.000000000141
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) P19010
Sequence length 71
Comment (sp|P19010|VITB1_XENLA) Vitellogenin-B1 OX=8355 OS=Xenopus laevis (African clawed frog). GN= OC=Xenopus.
Sequence
MRGIILAQLLALAGSEKSQYEPFFSESKPYVYNYEGIILNGIPENGLARSGIKLNCKAEI
SGYAQRSYMLK
Download sequence
Identical sequences P19010
gi|139639|sp|P19010| gi|313755|gb|CAA25616|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]