SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P20291 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P20291
Domain Number 1 Region: 4-138
Classification Level Classification E-value
Superfamily MAPEG domain-like 2.75e-37
Family MAPEG domain 0.000000262
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) P20291
Sequence length 161
Comment (sp|P20291|AL5AP_RAT) MK-886-binding protein KW=Complete proteome; Reference proteome OX=10116 OS=Rattus norvegicus (Rat). GN=Alox5ap; OC=Muroidea; Muridae; Murinae; Rattus.
Sequence
MDQEAVGNVVLLAIVTLISVVQNAFFAHKVELESKAQSGRSFQRTGTLAFERVYTANQNC
VDAYPTFLVVLWTAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIIL
FLFLMSLAGILNHYLIFFFGSDFENYIRTITTTISPLLLIP
Download sequence
Identical sequences P20291
10116.ENSRNOP00000001207 ENSRNOP00000001207 ENSRNOP00000001207 NP_058956.1.100692 NP_058956.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]