SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P20711 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P20711
Domain Number 1 Region: 1-474
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.37e-153
Family Pyridoxal-dependent decarboxylase 0.0000000000000951
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) P20711
Sequence length 480
Comment (sp|P20711|DDC_HUMAN) DOPA decarboxylase KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=DDC; OC=Catarrhini; Hominidae; Homo.
Sequence
MNASEFRRRGKEMVDYMANYMEGIEGRQVYPDVEPGYLRPLIPAAAPQEPDTFEDIINDV
EKIIMPGVTHWHSPYFFAYFPTASSYPAMLADMLCGAIGCIGFSWAASPACTELETVMMD
WLGKMLELPKAFLNEKAGEGGGVIQGSASEATLVALLAARTKVIHRLQAASPELTQAAIM
EKLVAYSSDQAHSSVERAGLIGGVKLKAIPSDGNFAMRASALQEALERDKAAGLIPFFMV
ATLGTTTCCSFDNLLEVGPICNKEDIWLHVDAAYAGSAFICPEFRHLLNGVEFADSFNFN
PHKWLLVNFDCSAMWVKKRTDLTGAFRLDPTYLKHSHQDSGLITDYRHWQIPLGRRFRSL
KMWFVFRMYGVKGLQAYIRKHVQLSHEFESLVRQDPRFEICVEVILGLVCFRLKGSNKVN
EALLQRINSAKKIHLVPCHLRDKFVLRFAICSRTVESAHVQRAWEHIKELAADVLRAERE
Download sequence
Identical sequences A0A0S2Z3N4 P20711
ENSP00000350616 ENSP00000350616 ENSP00000403644 ENSP00000350616 ENSP00000403644 9606.ENSP00000350616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]