SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P25161 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P25161
Domain Number 1 Region: 359-423
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000898
Family PCI domain (PINT motif) 0.05
Further Details:      
 
Weak hits

Sequence:  P25161
Domain Number - Region: 197-282
Classification Level Classification E-value
Superfamily HCP-like 0.00199
Family HCP-like 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) P25161
Sequence length 494
Comment (sp|P25161|PSMD3_DROME) Regulatory particle non-ATPase 3 KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=Rpn3; OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MTNATDIGANDVEMEVDPTAETLADEKKNQDVAAVQEIREQIRQIEKGVASKESRFILRV
LRNLPNTRRKLNGVVFRNLAQSIYPAGADREAAVALMPAVEKDATELPDVPKKQVATKAP
IAEVDAYFYLLLLVKLIDASDLKRAGISADALMAKISIQNRRTLDLIGAKSYFYFSRVAE
LKNSLEGIRSFLHARLRTATLRNDFEGQAVLINCLLRNYLHYALYDQADKLVKKSVYPES
ASNNEWARFLYYLGRIKAAKLEYSDAHKHLVQALRKSPQHAAIGFRQTVQKLIIVVELLL
GNIPERVVFRQAGLRQSLGAYFQLTQAVRLGNLKRFGDVVSQYGPKFQLDHTFTLIIRLR
HNVIKTAIRSIGLSYSRISPQDIAKRLMLDSAEDAEFIVSKAIRDGVIEATLDPAQNFMR
SKESTDIYSTREPQLAFHERISFCLNLHNQSVKAMRYPPKSYGKDLESAEERREREQQDL
ELAKEMAEDDEDGF
Download sequence
Identical sequences M9PG62 P25161
FBpp0291495 FBpp0291495 7227.FBpp0080691 FBpp0291495 NP_001260557.1.81976 NP_477300.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]