SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P28181 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P28181
Domain Number 1 Region: 19-262
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 1.29e-69
Family FdhD/NarQ 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) P28181
Sequence length 286
Comment (sp|P28181|FDHD_WOLSU) Sulfur carrier protein FdhD {ECO:0000255|HAMAP-Rule:MF_00187} KW=Complete proteome; Reference proteome OX=273121 OS=11488 / FDC 602W) (Vibrio succinogenes). GN=fdhD OC=Helicobacteraceae; Wolinella.
Sequence
MRHTDRFVKKVVIERIGDQRVLAEEEDVVIKEERISLYLNGTKLMSMMSLPSDQDAHAVG
FLMSEGVIEKIEDLKSVQISSDGSSVYVEALINHENITNLFKEKTLTSGCCVGVTGNLEG
NVLRKFIATPMQISLERIWEGMEEFEMSSHLFHETGCVHKASLLLEDGSKITAEDIGRHN
AIDKVMGKARLGRIDTEKAVLVVSGRLSMEMVVKAVMHNIPMIVSRAAATFLGIKTAQEL
GVTLVGFARGEKMNIYTHSGRVDLRACKRKRGVTLHAPNQSSSLLR
Download sequence
Identical sequences P28181
gi|34557521|ref|NP_907336.1| 273121.WS1149 WP_011139024.1.32730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]