SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P28575 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P28575
Domain Number 1 Region: 289-460
Classification Level Classification E-value
Superfamily Kelch motif 6.15e-45
Family Kelch motif 0.00011
Further Details:      
 
Domain Number 2 Region: 14-132
Classification Level Classification E-value
Superfamily POZ domain 5.02e-39
Family BTB/POZ domain 0.00091
Further Details:      
 
Domain Number 3 Region: 452-583
Classification Level Classification E-value
Superfamily Kelch motif 5.1e-35
Family Kelch motif 0.00033
Further Details:      
 
Weak hits

Sequence:  P28575
Domain Number - Region: 247-294
Classification Level Classification E-value
Superfamily PUG domain-like 0.0811
Family PUG domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) P28575
Sequence length 584
Comment (sp|P28575|IPP_MOUSE) Protein MIPP KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Ipp; OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MSKEECPKAADNSFSSDKHAQLILAQMNKMRSGQHFCDVQLQVGKETFQVHRLVLAASSP
YFAALFTGGMKESSKDVVQILGVEAGIFQLLLDFIYTGVVNIAVTNVQELIVAADMLQLT
EVVNLCCDFLKGQIDPQNCIGLFQFSEQIACHDLLEFTENYIHVHFLEVHTGEEFLGLTK
DQLIKILRSEELSIEDEYQVFLAAMQWILKDLGKRRKHVVEVLDPVRFPLLPSQRLLKYI
EGVSDFNLRVALQTLLKEYCEVCKSPKENKFCSFLQTSKVRPRKKARKYLYAVGGYTRLQ
GGRWSDSRALSCVERFDTFSQYWTTVSSLHQARCGLGVAVVGGMVYAIGGEKDSMIFDCT
ECYDPVTKQWTTVASMNHPRCGLGVCVCYGAIYALGGWVGAEIGNTIERFDPDENKWEVV
GSMAVSRYYFGCCEMQGLIYAVGGISNEGLELRSFEVYDPLSKRWSPLPPMGTRRAYLGV
AALNDCIYAIGGWNETQDALHTVEKYSFEEEKWVEVASMKVPRAGMCAVTVNGLLYVSGG
RSSSHDFLAPGTLDSVEVYNPHSDTWTEIGNMITSRCEGGVAVL
Download sequence
Identical sequences P28575
ENSMUSP00000030461 ENSMUSP00000030461 10090.ENSMUSP00000102088 MmR264 ENSMUSP00000030461 ENSMUSP00000102088 NP_032415.2.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]