SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P28651 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P28651
Domain Number 1 Region: 29-290
Classification Level Classification E-value
Superfamily Carbonic anhydrase 6.8e-80
Family Carbonic anhydrase 0.00000124
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) P28651
Sequence length 291
Comment (sp|P28651|CAH8_MOUSE) Carbonic anhydrase VIII KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Ca8; OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MADLSFIEDAVAFPEKEEDEEEEEEEGVEWGYEEGVEWGLVFPDANGEYQSPINLNSREA
RYDPSLLDVRLSPNYVVCRDCEVTNDGHTIQVILKSKSVLSGGPLPQGQEFELYEVRFHW
GRENQRGSEHTVNFKAFPMELHLIHWNSTLFGSIDEAVGKPHGIAIIALFVQIGKEHVGL
KAVTEILQDIQYKGKSKTIPCFNPNTLLPDPLLRDYWVYEGSLTIPPCSEGVTWILFRYP
LTISQMQIEEFRRLRTHVKGAELVEGCDGILGDNFRPTQPLSDRVIRAAFQ
Download sequence
Identical sequences P28651
ENSMUSP00000063511 ENSMUSP00000063511 NP_031618.2.92730 ENSMUSP00000063511 10090.ENSMUSP00000095891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]