SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P34686 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P34686
Domain Number 1 Region: 3-268
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 3.4e-90
Family Capz beta-1 subunit 0.0000000123
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) P34686
Sequence length 270
Comment (sp|P34686|CAPZB_CAEEL) F-actin-capping protein subunit beta KW=Complete proteome; Reference proteome OX=6239 OS=Caenorhabditis elegans. GN=cap-2; OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MGEQQLDCALDLMRRLPPQHCDKNLTDLIDLCPHLVDDLLSTIDQPLKIAADRETGKQYL
LCDYNRDGDSYRSPWSNTYDPPLEDGQLPSEKRRKMEIEANAAFESYRDLYFEGGVSSVY
FWDLDNGGFAGIVLIKKEGDGAKNITGCWDSIHVIEITERARQAHYKLTSTIMLWLQTNK
SSSGVMNLGGSLTRQHEMDAPINDQNTHLANMGRMIEDQESKMRLTINEIYFGKTKKVMS
DLRSTEKQSELEKQDEIVRELNNAMANRGN
Download sequence
Identical sequences P34686
CE01608___KOG3174 1312 CAA79270 M106.5 WR178 M106.5 M106.5.1 NP_496336.1.50509 M106.5 6239.M106.5.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]