SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P47740 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P47740
Domain Number 1 Region: 2-428
Classification Level Classification E-value
Superfamily ALDH-like 1.96e-129
Family ALDH-like 0.000000000031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) P47740
Sequence length 484
Comment (sp|P47740|AL3A2_MOUSE) Aldehyde dehydrogenase family 3 member A2 KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Aldh3a2; OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MERQVLRLRQAFRSGRSRPLRFRLQQLEALRRMVQEREKEILAAIAADLSKSELNAYSHE
VITILGEIDFMLGNLPELASARPAKKNLLTMMDEAYVQPEPLGVVLIIGAWNYPFVLTMQ
PLVGAIAAGNAAIVKPSELSENTAKILAELLPQYLDQDLYAIVNGGIPETTELLKQRFDH
ILYTGNTAVGKIVMEAAAKHLTPVTLELGGKSPCYIDRDCDLDVACRRIAWGKYMNCGQT
CIAPDYILCEASLQNQIVQKIKETVKDFYGENIKASPDYERIINLRHFKRLQSLLKGQKI
AFGGEMDEATRYLAPTILTDVDPNSKVMQEEIFGPILPIVSVKNVDEAINFINDREKPLA
LYVFSRNNKLIKRVIDETSSGGVTGNDVIMHFTVNSLPFGGVGASGMGAYHGKYSFDTFS
HQRPCLLKGLKGESVNKLRYPPNSESKVSWAKFFLLKQFNKGRLGMLLFVCLVAVAAVIV
KDQL
Download sequence
Identical sequences P47740
ENSMUSP00000073764 NP_031463.2.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]