SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P49057 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P49057
Domain Number 1 Region: 208-435
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 2.87e-55
Family N-type ATP pyrophosphatases 0.00000157
Further Details:      
 
Domain Number 2 Region: 28-220
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 7.34e-55
Family Class I glutamine amidotransferases (GAT) 0.00000641
Further Details:      
 
Domain Number 3 Region: 422-542
Classification Level Classification E-value
Superfamily GMP synthetase C-terminal dimerisation domain 2.48e-53
Family GMP synthetase C-terminal dimerisation domain 0.0000149
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) P49057
Sequence length 542
Comment (sp|P49057|GUAA_SYNY3) Glutamine amidotransferase KW=Complete proteome; Reference proteome OX=1111708 OS=Synechocystis sp. (strain PCC 6803 / Kazusa). GN=guaA; OC=Synechocystis.
Sequence
MTTQIPVPPVVSDQALPDRISDRLKGQIIVILDFGSQYSELIARRIRETEVYSEVLSYRT
TAQQLREIKPKGIILSGGPNSVYDQGAPECDPEIFQLGVPVLGVCYGMQLMVKQLGGRVE
RAKRGEYGKASLHIDDPTDLLTNVENDSTMWMSHGDSCVDLPTGFEILAHTDNTPCAAIA
DHQKALFGVQFHPEVVHSVGGIALIRNFVYHICHCEPTWTTAAFIEESIREVRSQVGDRR
VLLALSGGVDSSTLAFLLHRAIGDNLTCMFIDQGFMRKGEPERLVELFDHQFHIPVQYVN
ARDRFLKQLEGVTDPEEKRRLIGHEFIQVFEEESNRLGPFDYLAQGTLYPDVIESADSNV
DPKTGERVAVKIKSHHNVGGLPKNLRFKLVEPLRKLFKDEVRKLGRSIGLPEEIVRRHPF
PGPGLAIRIIGEVTSERLNILRDADFIVRDEISKRGIYHDYWQAFAVLLPIRSVGVMGDK
RTYAHPVVLRFITSEDGMTADWARVPYDILEAISNRIVNEVKGVNRVVYDITSKPPGTIE
WE
Download sequence
Identical sequences L8ASF1 P49057
WP_010873437.1.11876 WP_010873437.1.1889 WP_010873437.1.18904 WP_010873437.1.33690 WP_010873437.1.35395 WP_010873437.1.47586 WP_010873437.1.99424 1148.slr0213 gi|16331412|ref|NP_442140.1| gi|16331412|ref|NP_442140.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]