SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P57899 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P57899
Domain Number 1 Region: 4-203
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.59e-60
Family GHMP Kinase, N-terminal domain 0.0000182
Further Details:      
 
Domain Number 2 Region: 205-384
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 4.16e-50
Family Galactokinase 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) P57899
Sequence length 385
Comment (sp|P57899|GAL1_PASMU) Galactose kinase {ECO:0000255|HAMAP-Rule:MF_00246} KW=Complete proteome; Reference proteome OX=272843 OS=Pasteurella multocida (strain Pm70). GN=galK OC=Pasteurellaceae; Pasteurella.
Sequence
MTPQQSAQRLFQEKFNCTPTLNVYAPGRVNIIGEHTDYNDGFVMPCAINYGTAISGRKRD
DSRFKVYAGDLQQWDEFDLAQEITPDSSKKWTGYVRGVVKFVQTHCPDFKCGADLVISGN
VPLSAGLSSSASLEVAVGKFCQQLGNLPLTNTEIALIGQKAENQFVGCQCGNMDQLISAL
GQKDHLLMIDCRSLETIPTPIPANVAVMIVNSHVKHDLVAGEYNTRRQQCEVAAKFFGVK
ALRDVSLAQFKQREAELTALDPEVAKRARHVVTENQRVLDAVKALQSGNLALLGELMAQS
HESMRDDFEITVPQIDYLVELAQIAIGKTGGARMTGGGFGGCIVAVAPVEKVEAVRQIIA
DNYAQQTGLKEDFYVCTASQGVSVC
Download sequence
Identical sequences P57899
WP_010906982.1.12311 WP_010906982.1.15732 WP_010906982.1.19996 WP_010906982.1.40210 WP_010906982.1.45422 WP_010906982.1.4808 WP_010906982.1.53852 WP_010906982.1.6219 WP_010906982.1.62389 WP_010906982.1.66990 WP_010906982.1.81885 WP_010906982.1.8281 WP_010906982.1.89773 WP_010906982.1.9746 WP_010906982.1.9947 gi|15602900|ref|NP_245972.1| 272843.PM1035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]