SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P72742 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P72742
Domain Number 1 Region: 41-249
Classification Level Classification E-value
Superfamily ARM repeat 6.53e-39
Family PBS lyase HEAT-like repeat 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) P72742
Sequence length 252
Comment (tr|P72742|P72742_SYNY3) Slr1098 protein {ECO:0000313|EMBL:BAA16757.1} KW=Complete proteome; Reference proteome OX=1111708 OS=Synechocystis sp. (strain PCC 6803 / Kazusa). GN=slr1098 OC=Synechocystis.
Sequence
MRKYGAMRNQDDLLLEDSWVDPLDQLDDDVAPPPPDPDEMLVLLTSREAPQRMLAARAFC
EIADRRAVEPLINLLGDSCPLVRVSAAYALGRNTDPTIVEPLIQSLQTDFNGYVRKGLVW
ALGNCGDRRALAPLIHALKTDISAVRLWSASSLPNIAKLAYEDVIATIPPLIEGLRRDKM
AAVRSNCAWAVGQLCRELPSNVVYATAIDALLEALVEDEDFGVKEDAKSALLRLGDARGL
QMIEDLEMDGLI
Download sequence
Identical sequences L8AG54 P72742
gi|383324260|ref|YP_005385113.1| gi|16329349|ref|NP_440077.1| gi|383490144|ref|YP_005407820.1| 1148.slr1098 gi|16329349|ref|NP_440077.1| gi|383321090|ref|YP_005381943.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]