SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P73815 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P73815
Domain Number 1 Region: 10-84
Classification Level Classification E-value
Superfamily NE0471 N-terminal domain-like 0.00000000000000981
Family NE0471 N-terminal domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) P73815
Sequence length 98
Comment (tr|P73815|P73815_SYNY3) Ssl3692 protein {ECO:0000313|EMBL:BAA17869.1} KW=Complete proteome; Reference proteome OX=1111708 OS=Synechocystis sp. (strain PCC 6803 / Kazusa). GN=ssl3692 OC=Synechocystis.
Sequence
MNSQVKTPWLKAISVFPLDNFQLQIKLENGQELILDLQTIIETNDNYWRLKNPRYFRQAQ
IDPLGGIAWPEGEDLSPTGLERYAKIAFPSTINDGLMS
Download sequence
Identical sequences L8AJC6 P73815
WP_010872498.1.11876 WP_010872498.1.1889 WP_010872498.1.18904 WP_010872498.1.33690 WP_010872498.1.35395 WP_010872498.1.47586 WP_010872498.1.99424 gi|383491255|ref|YP_005408931.1| gi|16330461|ref|NP_441189.1| gi|383322202|ref|YP_005383055.1| gi|16330461|ref|NP_441189.1| gi|383325371|ref|YP_005386224.1| 1148.ssl3692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]