SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P80523 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P80523
Domain Number 1 Region: 1-178
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 4.18e-52
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) P80523
Sequence length 182
Comment (sp|P80523|PORC_METBF) Pyruvic-ferredoxin oxidoreductase subunit gamma KW=Complete proteome; Reference proteome OX=269797 OS=Methanosarcina barkeri (strain Fusaro / DSM 804). GN=porC; OC=Methanosarcinaceae; Methanosarcina.
Sequence
MKEIRIHGRGGQGSVTAAEMLSVAAFEDGKFSQAFPAFGVERRGAPVQAFTRINNNPIRL
RSQVYTPDYVIVQDATLLETVDVASGVKDDGIIIVNTTENPESLKLNTKARVMTVDATKV
AMDIIGVPIVNTVLLGAFAGATGEINVESIQHAIRARFSGKVGEKNANAIQKAYKLIRGE
EA
Download sequence
Identical sequences A0A0E3QP63 P80523
269797.Mbar_A1002 gi|73668535|ref|YP_304550.1| WP_011306019.1.36239 WP_011306019.1.74748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]