SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P98072 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P98072
Domain Number 1 Region: 780-1034
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.73e-87
Family Eukaryotic proteases 0.00000000613
Further Details:      
 
Domain Number 2 Region: 360-518
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.22e-36
Family MAM domain 0.006
Further Details:      
 
Domain Number 3 Region: 546-649
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.66e-27
Family Spermadhesin, CUB domain 0.0008
Further Details:      
 
Domain Number 4 Region: 246-351
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.93e-17
Family Spermadhesin, CUB domain 0.0014
Further Details:      
 
Domain Number 5 Region: 64-165
Classification Level Classification E-value
Superfamily SEA domain 4.32e-16
Family SEA domain 0.0099
Further Details:      
 
Domain Number 6 Region: 689-790
Classification Level Classification E-value
Superfamily SRCR-like 0.0000000000000209
Family Scavenger receptor cysteine-rich (SRCR) domain 0.013
Further Details:      
 
Domain Number 7 Region: 657-694
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000157
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 8 Region: 197-236
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000236
Family LDL receptor-like module 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) P98072
Sequence length 1035
Comment (sp|P98072|ENTK_BOVIN) Enteropeptidase catalytic light chain KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=TMPRSS15; OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MGSKRSVPSRHRSLTTYEVMFAVLFVILVALCAGLIAVSWLSIQGSVKDAAFGKSHEARG
TLKIISGATYNPHLQDKLSVDFKVLAFDIQQMIDDIFQSSNLKNEYKNSRVLQFENGSII
VIFDLLFDQWVSDKNVKEELIQGIEANKSSQLVTFHIDLNSIDITASLENFSTISPATTS
EKLTTSIPLATPGNVSIECPPDSRLCADALKCIAIDLFCDGELNCPDGSDEDNKTCATAC
DGRFLLTGSSGSFEALHYPKPSNNTSAVCRWIIRVNQGLSIQLNFDYFNTYYADVLNIYE
GMGSSKILRASLWSNNPGIIRIFSNQVTATFLIQSDESDYIGFKVTYTAFNSKELNNYEK
INCNFEDGFCFWIQDLNDDNEWERTQGSTFPPSTGPTFDHTFGNESGFYISTPTGPGGRR
ERVGLLTLPLDPTPEQACLSFWYYMYGENVYKLSINISSDQNMEKTIFQKEGNYGQNWNY
GQVTLNETVEFKVSFYGFKNQILSDIALDDISLTYGICNVSVYPEPTLVPTPPPELPTDC
GGPHDLWEPNTTFTSINFPNSYPNQAFCIWNLNAQKGKNIQLHFQEFDLENIADVVEIRD
GEGDDSLFLAVYTGPGPVNDVFSTTNRMTVLFITDNMLAKQGFKANFTTGYGLGIPEPCK
EDNFQCKDGECIPLVNLCDGFPHCKDGSDEAHCVRLFNGTTDSSGLVQFRIQSIWHVACA
ENWTTQISDDVCQLLGLGTGNSSVPTFSTGGGPYVNLNTAPNGSLILTPSQQCLEDSLIL
LQCNYKSCGKKLVTQEVSPKIVGGSDSREGAWPWVVALYFDDQQVCGASLVSRDWLVSAA
HCVYGRNMEPSKWKAVLGLHMASNLTSPQIETRLIDQIVINPHYNKRRKNNDIAMMHLEM
KVNYTDYIQPICLPEENQVFPPGRICSIAGWGALIYQGSTADVLQEADVPLLSNEKCQQQ
MPEYNITENMVCAGYEAGGVDSCQGDSGGPLMCQENNRWLLAGVTSFGYQCALPNRPGVY
ARVPRFTEWIQSFLH
Download sequence
Identical sequences P98072
ENSBTAP00000000788 ENSBTAP00000000788 NP_776864.1.59421 NP_776864.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]