SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P98164 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P98164
Domain Number 1 Region: 3199-3463
Classification Level Classification E-value
Superfamily YWTD domain 7.06e-53
Family YWTD domain 0.00000262
Further Details:      
 
Domain Number 2 Region: 396-657
Classification Level Classification E-value
Superfamily YWTD domain 4.19e-45
Family YWTD domain 0.00000851
Further Details:      
 
Domain Number 3 Region: 711-963
Classification Level Classification E-value
Superfamily YWTD domain 1.7e-43
Family YWTD domain 0.0000178
Further Details:      
 
Domain Number 4 Region: 1438-1699
Classification Level Classification E-value
Superfamily YWTD domain 3.66e-43
Family YWTD domain 0.00001
Further Details:      
 
Domain Number 5 Region: 2389-2632
Classification Level Classification E-value
Superfamily YWTD domain 1.7e-37
Family YWTD domain 0.0000201
Further Details:      
 
Domain Number 6 Region: 1746-2012
Classification Level Classification E-value
Superfamily YWTD domain 1.01e-36
Family YWTD domain 0.0000923
Further Details:      
 
Domain Number 7 Region: 2065-2335
Classification Level Classification E-value
Superfamily YWTD domain 1.2e-36
Family YWTD domain 0.000028
Further Details:      
 
Domain Number 8 Region: 4055-4326
Classification Level Classification E-value
Superfamily YWTD domain 1.83e-36
Family YWTD domain 0.0000269
Further Details:      
 
Domain Number 9 Region: 304-385,650-706
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.98e-16
Family Growth factor receptor domain 0.021
Further Details:      
 
Domain Number 10 Region: 1338-1430,1726-1740,2010-2061
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000173
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 11 Region: 2735-2776
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000013
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 12 Region: 1065-1103
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000327
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 13 Region: 3144-3192
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000046
Family EGF-type module 0.0066
Further Details:      
 
Domain Number 14 Region: 2987-3028
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000563
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 15 Region: 3627-3666
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000785
Family LDL receptor-like module 0.00066
Further Details:      
 
Domain Number 16 Region: 2857-2896
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000903
Family LDL receptor-like module 0.00062
Further Details:      
 
Domain Number 17 Region: 1147-1184
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000012
Family LDL receptor-like module 0.0009
Further Details:      
 
Domain Number 18 Region: 1265-1306
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000144
Family LDL receptor-like module 0.0009
Further Details:      
 
Domain Number 19 Region: 3026-3066
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000209
Family LDL receptor-like module 0.00076
Further Details:      
 
Domain Number 20 Region: 3510-3546
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000327
Family LDL receptor-like module 0.00098
Further Details:      
 
Domain Number 21 Region: 3718-3755
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000419
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 22 Region: 3069-3109
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000458
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 23 Region: 101-143
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000694
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 24 Region: 26-63
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000864
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 25 Region: 3758-3795
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000011
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 26 Region: 2699-2742
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000114
Family LDL receptor-like module 0.00071
Further Details:      
 
Domain Number 27 Region: 182-219
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000012
Family LDL receptor-like module 0.00094
Further Details:      
 
Domain Number 28 Region: 2904-2939
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000127
Family LDL receptor-like module 0.00058
Further Details:      
 
Domain Number 29 Region: 1106-1143
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000183
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 30 Region: 1023-1060
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000209
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 31 Region: 3841-3876
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000209
Family LDL receptor-like module 0.00093
Further Details:      
 
Domain Number 32 Region: 216-256
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000275
Family LDL receptor-like module 0.00092
Further Details:      
 
Domain Number 33 Region: 3793-3833
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000275
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 34 Region: 3585-3629
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000353
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 35 Region: 3111-3159
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000533
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 36 Region: 1229-1265
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000864
Family LDL receptor-like module 0.00075
Further Details:      
 
Domain Number 37 Region: 1186-1224
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000106
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 38 Region: 3926-3962
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000115
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 39 Region: 65-101
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000119
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 40 Region: 264-301
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000209
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number 41 Region: 3547-3588
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000249
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 42 Region: 2820-2859
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000262
Family LDL receptor-like module 0.00098
Further Details:      
 
Domain Number 43 Region: 3882-3920
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000537
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 44 Region: 1310-1346
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000707
Family LDL receptor-like module 0.003
Further Details:      
 
Domain Number 45 Region: 2943-2986
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000288
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 46 Region: 3681-3714
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000327
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 47 Region: 4007-4041
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000466
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 48 Region: 146-180
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000262
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 49 Region: 4381-4414
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000544
Family EGF-type module 0.02
Further Details:      
 
Domain Number 50 Region: 2783-2817
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000102
Family LDL receptor-like module 0.0022
Further Details:      
 
Weak hits

Sequence:  P98164
Domain Number - Region: 2341-2385
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000272
Family EGF-type module 0.018
Further Details:      
 
Domain Number - Region: 1700-1746
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000389
Family EGF-type module 0.0093
Further Details:      
 
Domain Number - Region: 3969-4008
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00343
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 979-1019
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00388
Family EGF-type module 0.013
Further Details:      
 
Domain Number - Region: 3468-3529
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0127
Family EGF-type module 0.034
Further Details:      
 
Domain Number - Region: 4335-4360
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0146
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 2654-2714
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0568
Family EGF-type module 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) P98164
Sequence length 4655
Comment (sp|P98164|LRP2_HUMAN) Megalin KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=LRP2 OC=Catarrhini; Hominidae; Homo.
Sequence
MDRGPAAVACTLLLALVACLAPASGQECDSAHFRCGSGHCIPADWRCDGTKDCSDDADEI
GCAVVTCQQGYFKCQSEGQCIPNSWVCDQDQDCDDGSDERQDCSQSTCSSHQITCSNGQC
IPSEYRCDHVRDCPDGADENDCQYPTCEQLTCDNGACYNTSQKCDWKVDCRDSSDEINCT
EICLHNEFSCGNGECIPRAYVCDHDNDCQDGSDEHACNYPTCGGYQFTCPSGRCIYQNWV
CDGEDDCKDNGDEDGCESGPHDVHKCSPREWSCPESGRCISIYKVCDGILDCPGREDENN
TSTGKYCSMTLCSALNCQYQCHETPYGGACFCPPGYIINHNDSRTCVEFDDCQIWGICDQ
KCESRPGRHLCHCEEGYILERGQYCKANDSFGEASIIFSNGRDLLIGDIHGRSFRILVES
QNRGVAVGVAFHYHLQRVFWTDTVQNKVFSVDINGLNIQEVLNVSVETPENLAVDWVNNK
IYLVETKVNRIDMVNLDGSYRVTLITENLGHPRGIAVDPTVGYLFFSDWESLSGEPKLER
AFMDGSNRKDLVKTKLGWPAGVTLDMISKRVYWVDSRFDYIETVTYDGIQRKTVVHGGSL
IPHPFGVSLFEGQVFFTDWTKMAVLKANKFTETNPQVYYQASLRPYGVTVYHSLRQPYAT
NPCKDNNGGCEQVCVLSHRTDNDGLGFRCKCTFGFQLDTDERHCIAVQNFLIFSSQVAIR
GIPFTLSTQEDVMVPVSGNPSFFVGIDFDAQDSTIFFSDMSKHMIFKQKIDGTGREILAA
NRVENVESLAFDWISKNLYWTDSHYKSISVMRLADKTRRTVVQYLNNPRSVVVHPFAGYL
FFTDWFRPAKIMRAWSDGSHLLPVINTTLGWPNGLAIDWAASRLYWVDAYFDKIEHSTFD
GLDRRRLGHIEQMTHPFGLAIFGEHLFFTDWRLGAIIRVRKADGGEMTVIRSGIAYILHL
KSYDVNIQTGSNACNQPTHPNGDCSHFCFPVPNFQRVCGCPYGMRLASNHLTCEGDPTNE
PPTEQCGLFSFPCKNGRCVPNYYLCDGVDDCHDNSDEQLCGTLNNTCSSSAFTCGHGECI
PAHWRCDKRNDCVDGSDEHNCPTHAPASCLDTQYTCDNHQCISKNWVCDTDNDCGDGSDE
KNCNSTETCQPSQFNCPNHRCIDLSFVCDGDKDCVDGSDEVGCVLNCTASQFKCASGDKC
IGVTNRCDGVFDCSDNSDEAGCPTRPPGMCHSDEFQCQEDGICIPNFWECDGHPDCLYGS
DEHNACVPKTCPSSYFHCDNGNCIHRAWLCDRDNDCGDMSDEKDCPTQPFRCPSWQWQCL
GHNICVNLSVVCDGIFDCPNGTDESPLCNGNSCSDFNGGCTHECVQEPFGAKCLCPLGFL
LANDSKTCEDIDECDILGSCSQHCYNMRGSFRCSCDTGYMLESDGRTCKVTASESLLLLV
ASQNKIIADSVTSQVHNIYSLVENGSYIVAVDFDSISGRIFWSDATQGKTWSAFQNGTDR
RVVFDSSIILTETIAIDWVGRNLYWTDYALETIEVSKIDGSHRTVLISKNLTNPRGLALD
PRMNEHLLFWSDWGHHPRIERASMDGSMRTVIVQDKIFWPCGLTIDYPNRLLYFMDSYLD
YMDFCDYNGHHRRQVIASDLIIRHPYALTLFEDSVYWTDRATRRVMRANKWHGGNQSVVM
YNIQWPLGIVAVHPSKQPNSVNPCAFSRCSHLCLLSSQGPHFYSCVCPSGWSLSPDLLNC
LRDDQPFLITVRQHIIFGISLNPEVKSNDAMVPIAGIQNGLDVEFDDAEQYIYWVENPGE
IHRVKTDGTNRTVFASISMVGPSMNLALDWISRNLYSTNPRTQSIEVLTLHGDIRYRKTL
IANDGTALGVGFPIGITVDPARGKLYWSDQGTDSGVPAKIASANMDGTSVKTLFTGNLEH
LECVTLDIEEQKLYWAVTGRGVIERGNVDGTDRMILVHQLSHPWGIAVHDSFLYYTDEQY
EVIERVDKATGANKIVLRDNVPNLRGLQVYHRRNAAESSNGCSNNMNACQQICLPVPGGL
FSCACATGFKLNPDNRSCSPYNSFIVVSMLSAIRGFSLELSDHSETMVPVAGQGRNALHV
DVDVSSGFIYWCDFSSSVASDNAIRRIKPDGSSLMNIVTHGIGENGVRGIAVDWVAGNLY
FTNAFVSETLIEVLRINTTYRRVLLKVTVDMPRHIVVDPKNRYLFWADYGQRPKIERSFL
DCTNRTVLVSEGIVTPRGLAVDRSDGYVYWVDDSLDIIARIRINGENSEVIRYGSRYPTP
YGITVFENSIIWVDRNLKKIFQASKEPENTEPPTVIRDNINWLRDVTIFDKQVQPRSPAE
VNNNPCLENNGGCSHLCFALPGLHTPKCDCAFGTLQSDGKNCAISTENFLIFALSNSLRS
LHLDPENHSPPFQTINVERTVMSLDYDSVSDRIYFTQNLASGVGQISYATLSSGIHTPTV
IASGIGTADGIAFDWITRRIYYSDYLNQMINSMAEDGSNRTVIARVPKPRAIVLDPCQGY
LYWADWDTHAKIERATLGGNFRVPIVNSSLVMPSGLTLDYEEDLLYWVDASLQRIERSTL
TGVDREVIVNAAVHAFGLTLYGQYIYWTDLYTQRIYRANKYDGSGQIAMTTNLLSQPRGI
NTVVKNQKQQCNNPCEQFNGGCSHICAPGPNGAECQCPHEGNWYLANNRKHCIVDNGERC
GASSFTCSNGRCISEEWKCDNDNDCGDGSDEMESVCALHTCSPTAFTCANGRCVQYSYRC
DYYNDCGDGSDEAGCLFRDCNATTEFMCNNRRCIPREFICNGVDNCHDNNTSDEKNCPDR
TCQSGYTKCHNSNICIPRVYLCDGDNDCGDNSDENPTYCTTHTCSSSEFQCASGRCIPQH
WYCDQETDCFDASDEPASCGHSERTCLADEFKCDGGRCIPSEWICDGDNDCGDMSDEDKR
HQCQNQNCSDSEFLCVNDRPPDRRCIPQSWVCDGDVDCTDGYDENQNCTRRTCSENEFTC
GYGLCIPKIFRCDRHNDCGDYSDERGCLYQTCQQNQFTCQNGRCISKTFVCDEDNDCGDG
SDELMHLCHTPEPTCPPHEFKCDNGRCIEMMKLCNHLDDCLDNSDEKGCGINECHDPSIS
GCDHNCTDTLTSFYCSCRPGYKLMSDKRTCVDIDECTEMPFVCSQKCENVIGSYICKCAP
GYLREPDGKTCRQNSNIEPYLIFSNRYYLRNLTIDGYFYSLILEGLDNVVALDFDRVEKR
LYWIDTQRQVIERMFLNKTNKETIINHRLPAAESLAVDWVSRKLYWLDARLDGLFVSDLN
GGHRRMLAQHCVDANNTFCFDNPRGLALHPQYGYLYWADWGHRAYIGRVGMDGTNKSVII
STKLEWPNGITIDYTNDLLYWADAHLGYIEYSDLEGHHRHTVYDGALPHPFAITIFEDTI
YWTDWNTRTVEKGNKYDGSNRQTLVNTTHRPFDIHVYHPYRQPIVSNPCGTNNGGCSHLC
LIKPGGKGFTCECPDDFRTLQLSGSTYCMPMCSSTQFLCANNEKCIPIWWKCDGQKDCSD
GSDELALCPQRFCRLGQFQCSDGNCTSPQTLCNAHQNCPDGSDEDRLLCENHHCDSNEWQ
CANKRCIPESWQCDTFNDCEDNSDEDSSHCASRTCRPGQFRCANGRCIPQAWKCDVDNDC
GDHSDEPIEECMSSAHLCDNFTEFSCKTNYRCIPKWAVCNGVDDCRDNSDEQGCEERTCH
PVGDFRCKNHHCIPLRWQCDGQNDCGDNSDEENCAPRECTESEFRCVNQQCIPSRWICDH
YNDCGDNSDERDCEMRTCHPEYFQCTSGHCVHSELKCDGSADCLDASDEADCPTRFPDGA
YCQATMFECKNHVCIPPYWKCDGDDDCGDGSDEELHLCLDVPCNSPNRFRCDNNRCIYSH
EVCNGVDDCGDGTDETEEHCRKPTPKPCTEYEYKCGNGHCIPHDNVCDDADDCGDWSDEL
GCNKGKERTCAENICEQNCTQLNEGGFICSCTAGFETNVFDRTSCLDINECEQFGTCPQH
CRNTKGSYECVCADGFTSMSDRPGKRCAAEGSSPLLLLPDNVRIRKYNLSSERFSEYLQD
EEYIQAVDYDWDPKDIGLSVVYYTVRGEGSRFGAIKRAYIPNFESGRNNLVQEVDLKLKY
VMQPDGIAVDWVGRHIYWSDVKNKRIEVAKLDGRYRKWLISTDLDQPAAIAVNPKLGLMF
WTDWGKEPKIESAWMNGEDRNILVFEDLGWPTGLSIDYLNNDRIYWSDFKEDVIETIKYD
GTDRRVIAKEAMNPYSLDIFEDQLYWISKEKGEVWKQNKFGQGKKEKTLVVNPWLTQVRI
FHQLRYNKSVPNLCKQICSHLCLLRPGGYSCACPQGSSFIEGSTTECDAAIELPINLPPP
CRCMHGGNCYFDETDLPKCKCPSGYTGKYCEMAFSKGISPGTTAVAVLLTILLIVVIGAL
AIAGFFHYRRTGSLLPALPKLPSLSSLVKPSENGNGVTFRSGADLNMDIGVSGFGPETAI
DRSMAMSEDFVMEMGKQPIIFENPMYSARDSAVKVVQPIQVTVSENVDNKNYGSPINPSE
IVPETNPTSPAADGTQVTKWNLFKRKSKQTTNFENPIYAQMENEQKESVAATPPPSPSLP
AKPKPPSRRDPTPTYSATEDTFKDTANLVKEDSEV
Download sequence
Identical sequences P98164
ENSP00000263816 ENSP00000263816 NP_004516.2.87134 NP_004516.2.92137 ENSP00000263816 9606.ENSP00000263816 gi|126012573|ref|NP_004516.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]