SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q01KZ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q01KZ7
Domain Number 1 Region: 72-171
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000275
Family B3 DNA binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q01KZ7
Sequence length 194
Comment (tr|Q01KZ7|Q01KZ7_ORYSA) OSIGBa0148P16.8 protein {ECO:0000313|EMBL:CAH66574.1} OX=4530 OS=Oryza sativa (Rice). GN=OSIGBa0148P16.8 OC=Oryzoideae; Oryzeae; Oryzinae; Oryza.
Sequence
MASDPTELRCSSPESSGDAGAEDPAAVDAAEESGGEGGSGHIAAGTEAAPPRPPEPEPEK
VARHGVLPLLGKPYFTCIMCKSHVQPPFQVVVPRSFAPLLPSRTTPATLSWRGRSWGMRF
TGGRLIQRLEAGWRGFAVDNDLRLGDGCVFELLVGGGGEQERVEFRVQVLRAEIPARIRG
RAGGYTSATPIVID
Download sequence
Identical sequences A0A0D3FV40 A2XSR4 Q01KZ7
OBART04G10380.1 39946.BGIOSIBCE014941 OsIBCD014113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]