SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q01WF8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q01WF8
Domain Number 1 Region: 125-385
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 8.65e-52
Family D-glucarate dehydratase-like 0.0011
Further Details:      
 
Domain Number 2 Region: 31-141
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.22e-24
Family Enolase N-terminal domain-like 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q01WF8
Sequence length 412
Comment (tr|Q01WF8|Q01WF8_SOLUE) Mandelate racemase/muconate lactonizing enzyme, N-terminal domain protein {ECO:0000313|EMBL:ABJ86007.1} KW=Complete proteome; Reference proteome OX=234267 OS=Solibacter usitatus (strain Ellin6076). GN=Acid_5052 OC=Solibacteraceae; Candidatus Solibacter.
Sequence
MNRRTLLRSAAAAAGLSLAGRDAARAAIPKMKVTRVRVYSPPNPNPLFNQSDMVVTVETD
AGITGIGEGGSRDTLEQCAGRLIGQDPRYIERLWQDMARSFFYPPGREKIHALGALDLAL
WDIQGKVLGRPVHALLGGMARNFCECYPTAGVIPGVRGGMPIKEHAQAVMAAGYRAFRMG
AADTPANGTFNTHERLNKMAEDCAQAREGVGKNGDWCIDFHQRFDLSEAIRGCDLIKDFA
PYFVEDPVRTEAFLEDIPLLRRSAKVPIAAGEEWGYRWDFNKLVEGHDIDYIRATLPNVG
GITEMMKIAAICETHFVGIIPHFTGPIATAALVHALGVFSGPVLVEFTYQGIVKPYLPVW
LDFREGKLYPNDRPGLGVELDLKPLKLVSEITERVTARAQVYYRPDGSITNW
Download sequence
Identical sequences Q01WF8
WP_011686757.1.46729 gi|116624136|ref|YP_826292.1| 234267.Acid_5052 NYSGXRC-9849a

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]