SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q01YW7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q01YW7
Domain Number 1 Region: 11-383
Classification Level Classification E-value
Superfamily Homocysteine S-methyltransferase 6.54e-110
Family Homocysteine S-methyltransferase 0.00000757
Further Details:      
 
Domain Number 2 Region: 900-1178
Classification Level Classification E-value
Superfamily Methionine synthase activation domain-like 3.79e-80
Family Methionine synthase SAM-binding domain 0.00025
Further Details:      
 
Domain Number 3 Region: 341-606
Classification Level Classification E-value
Superfamily Dihydropteroate synthetase-like 1.31e-74
Family Methyltetrahydrofolate-utiluzing methyltransferases 0.00071
Further Details:      
 
Domain Number 4 Region: 743-880
Classification Level Classification E-value
Superfamily Cobalamin (vitamin B12)-binding domain 5.63e-39
Family Cobalamin (vitamin B12)-binding domain 0.0000527
Further Details:      
 
Domain Number 5 Region: 656-740
Classification Level Classification E-value
Superfamily Methionine synthase domain 1.96e-23
Family Methionine synthase domain 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q01YW7
Sequence length 1185
Comment (tr|Q01YW7|Q01YW7_SOLUE) 5-methyltetrahydrofolate--homocysteine methyltransferase {ECO:0000256|PIRNR:PIRNR000381} KW=Complete proteome; Reference proteome OX=234267 OS=Solibacter usitatus (strain Ellin6076). GN=Acid_4184 OC=Solibacteraceae; Candidatus Solibacter.
Sequence
MTNFLERQKALNDSLEQRVLVLDGAMGTMIHQAPLSIETDYLGRENCPEILNVTRPDVIQ
DIHRQYLEAGADIIETNTFGGTRIALADNKLEERAYELNFAAAKLAREVADQFSTAAKPR
FVAGSIGPTNKDLNITGSTTFPEIKAAYYEQAKGLVEGGADYLLIETCFDTGSLKAGLVA
VEQLGRELAIQIPVVASVTIERTGTMLGGQQIDALYASIGNHELLGVGMNCATGPDLMTD
HIRTLNEMSAHRISCYPNAGLPNAEGKFGETPDSLAAQLEKFANQGWLNFVGGCCGTTPA
HIQAIAQMIQGKRPRATPASKHRAYYSGIDLVEAEDSNRPLLVGERTNVIGSRLFKNLIA
DEKWEEATDIARRQVRNGAHVIDVCLQSTDREELEDIRPFYEKLIRKIKAPIMIDTTDPK
AVELALTYCQGKSIINSVNLEDGEEKFERLCPIAKLYGAALVVGSIDEDKLQAQAFTRER
KVAVAERSYRLLTEKYGIPGEDIIIDPLVFPCATGDVNYIGGAVETIEGIRLVKQALPYA
KTVLGISNISFGLPAAAREVVNSVFLYYCTKAGLDLAIVNAEKLERFASIPEEERRLAEH
LLFNTPPAGAEDESLRTAAEDWRAQSPEQKAAINQFHIAAIAEHFRKAGARVKKAAADMP
LDQRLANYIIEGTKDGLIADLDRKRAEGATPLEIINGPLMAGMSEVGRLFNNNELIVAEV
LQSAEAMKAAVNHLEQFMEKADTAARGKVLLATVKGDVHDIGKNLVEIILANNGYEVINL
GIKVPPDVLIQAFREHMPDAIGLSGLLVKSTQQMVITATDLKAAGIDVPLLVGGAALSEK
FTRTKIGPAYSEAVCYAKDAMTGLSLMNRLMDPAEREALIATSTTLEAPAAVEAPAEPLG
PLSTRRSRKVRTELPVPPAPYLERKVRDVPNLADVWSYINPFMIYGRHLGYKGNFEKALA
EHEEKALELFHNVEELKHEAAQFMHVKAVWQFFEAERDGNAIHLFAPGGASPIHTFRFGR
QRREDGLCLSDYILDSPDGKRDHLALFVTTAGAGIRERSEQWKKAGEFFKAHAIQALAIE
TAEATAEWLHRRIREDWGFPDPPTTTMHDRFTSKYHGKRYSFGYPACPNLDDQQGVWKLI
NPDDIGVKLTEGMMMEPEASVSAIVFHHPDCAYFTADEGESEATA
Download sequence
Identical sequences Q01YW7
234267.Acid_4184 WP_011685902.1.46729 gi|116623277|ref|YP_825433.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]