SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q026S2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q026S2
Domain Number 1 Region: 35-298
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 2.28e-72
Family Proline dehydrohenase domain of bifunctional PutA protein 0.0000954
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q026S2
Sequence length 303
Comment (tr|Q026S2|Q026S2_SOLUE) L-proline dehydrogenase {ECO:0000313|EMBL:ABJ82997.1} KW=Complete proteome; Reference proteome OX=234267 OS=Solibacter usitatus (strain Ellin6076). GN=Acid_2007 OC=Solibacteraceae; Candidatus Solibacter.
Sequence
MVRAFFLFLSRQKQLRRWMETSPVAQRLSKRFVAGETLEQALAVSRKLNKQGITVTLDHL
GESVTSLAEAREARDVYRRTLDAIHAGDIQGNVSLKLTQFGLDLSYEECLANVEQLVRRA
AELGSFVRVDMESSEYVDRTLDLVRTLHARHGAVGVVIQSYLYRSKDDIAKLCAEKIRVR
LCKGAYLEPASLAFPQKSDVDRSYVELTQKLLTYGVYPAIATHDEAMIGQTKQFVSSKGI
GRECFEFQMLYGIRADLQRQLVADGYRLRLYVPFGKAWYPYYMRRLAERPANVLFILRNL
FRT
Download sequence
Identical sequences Q026S2
WP_011683770.1.46729 234267.Acid_2007 gi|116621126|ref|YP_823282.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]