SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q05E02 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q05E02
Domain Number - Region: 17-55
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00836
Family Recombinase DNA-binding domain 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q05E02
Sequence length 57
Comment (tr|Q05E02|Q05E02_AERPE) Uncharacterized protein {ECO:0000313|EMBL:BAF34799.1} KW=Complete proteome; Reference proteome OX=272557 OS=100138 / K1). GN=APE_1558c OC=Desulfurococcaceae; Aeropyrum.
Sequence
MVVMPDRREWWEAVDPARLREDARYRILRRVVEKHGRKQVVELAGVSRVTLWRLLGH
Download sequence
Identical sequences Q05E02
gi|118431509|ref|YP_874902.1| 272557.APE_1558c

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]