SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q07H56 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q07H56
Domain Number - Region: 8-92
Classification Level Classification E-value
Superfamily Cation efflux protein transmembrane domain-like 0.00392
Family Cation efflux protein transmembrane domain-like 0.025
Further Details:      
 
Domain Number - Region: 91-143
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00693
Family NfeD domain-like 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q07H56
Sequence length 145
Comment (tr|Q07H56|Q07H56_RHOP5) Uncharacterized protein {ECO:0000313|EMBL:ABJ08728.1} KW=Complete proteome; Reference proteome OX=316055 OS=Rhodopseudomonas palustris (strain BisA53). GN=RPE_4809 OC=Bradyrhizobiaceae; Rhodopseudomonas.
Sequence
MTELIASMGSWNWLILGFILIALEMLAPGIFLFWLGLAALLVGGMSMLTDPSWQAQLLAF
ALFAISAVPLWRHFARTTSETAPFLNRRADALVGREFTLEKPIVDGVGTVRIDDTIWRIS
GPDIAAGSKIKIVHADGANLTVAAA
Download sequence
Identical sequences Q07H56
gi|115526797|ref|YP_783708.1| 316055.RPE_4809 WP_011666182.1.72802

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]